Entry information : PtPrx40 (POPTR_0013s15050 / Potri.013G154400)
Entry ID 3118
Creation 2009-01-28 (Christophe Dunand)
Last sequence changes 2010-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx40 (POPTR_0013s15050 / Potri.013G154400)
Name (synonym) PtPrx40 (POPTR_0013s15050 / Potri.013G154400)
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx40
start..stop
S start..stop
RcPrx52 531 0 45..360 1..317
MePrx20 506 0 45..360 11..329
CclPrx113 499 1.2e-179 51..360 7..318
NnPrx84 492 1.64e-176 45..360 14..331
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3118' 'join(15105672..15106010,15106294..15106485,15106674..15106839,15106931..15107316)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 15105672..15106010 337 N° 2 15106294..15106485 190 N° 3 15106674..15106839 164 N° 4 15106931..15107316 384
join(15105672..15106010,15106294..15106485,15106674..15106839,15106931..15107316 )


exon

Literature and cross-references PtPrx40 (POPTR_0013s15050 / Potri.013G154400)
DNA ref. Phytozome 12:   scaffold_13 (15105672..15107316)
Omic ref. ePlant:   Potri.013G154400
Protein sequence: PtPrx40 (POPTR_0013s15050 / Potri.013G154400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   360
PWM (Da):   %s   38651.23  
PI (pH):   %s   6.58
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVDGPDQMLPINRPPLQHLHAIDQTQEIYHKFNYIPLCLYILDYMALSKIFYGLCFSMLLLGLVHAQLSTTFYATTCPKALSTIRTAVLKAVVKEHRMGASLLRLHFHDCFVNGCDASVL
LDDTSSFTGEKTAGPNANSLRGYDVIDTIKSQLESICPGVVSCADILAVAARDSVVA
LSGPSWTVQLGRRDSTTASLGAANSDLPSPLMDLSDLITSFSNKGFTAKEMVALSGSHTIGQA
RCLLFRNRVYNETSLDSTLATSLKSNCPNTGSDDSLSSLDATTPVTFDNSYFKNLANNKGLLHSDQQLFSGGTTDSQVKTYSINSATFYADFASAMVKMGSISPLTGSDGQIRTNCAKVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 13, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGACGGTCCAGACCAAATGCTTCCTATAAATAGGCCTCCTCTACAGCACTTACATGCCATCGATCAAACACAAGAGATATATCACAAGTTCAACTATATCCCTCTGTGTCTTTAC
ATTTTGGATTATATGGCTCTCTCAAAAATTTTCTACGGGTTATGTTTCTCTATGCTTTTGCTTGGATTAGTCCATGCACAGTTATCAACCACTTTCTATGCAACAACATGCCCTAAAGCC
CTCTCTACCATCAGAACTGCTGTACTAAAAGCAGTTGTCAAGGAGCATCGCATGGGAGCCTCCTTGCTCCGTCTCCATTTCCATGACTGCTTCGTTAAT
ATGCATGTTTCTCTTATCCCT
CTCCCTTTCTTTCACATACAGATATACATGCACACACAAGAGTGGGGAAGGAAGAAGGATATTAAGATTGTGCCTTGGGGAGGATAGTCTCTCCATGTTTTAGGTTTTTTAGTTTACCAA
CTTGCACGTAAAACCTTGCATGCATGCACAAGGATGATAGTATACTGTGTGTTTAATTACTATATACAATAATTTCATTAAGAAATGTTATCGTTATTTTAAACATTGTAATTTGACGAG
GATCTTTATTATTGATTCAAGCAGGGATGTGATGCATCAGTCCTATTAGATGACACTTCAAGTTTTACTGGAGAAAAGACTGCAGGCCCAAATGCAAATTCTTTGAGAGGTTATGATGTG
ATTGATACCATTAAGTCTCAATTGGAGTCAATTTGCCCTGGAGTTGTTTCTTGTGCTGATATTCTGGCTGTTGCTGCTCGAGATTCAGTTGTTGCA
CAGTAAGTAACCTAAAGCATATAT
ATAAGACAAGGTGCCTTCAAAGGCATTGAAATCCTTTTGAACCCTGATGTTTGAATGCTGATGCATGCCTTTTAAGGCCGTGAAGAAGGCACCGTGGAAACGACTCAATCCATACATTTC
ACATAAACTTGTGCGCATTTTGATTTCTTTTATATTTCTTCTCCAGTTGAGTGGACCTTCATGGACAGTTCAATTGGGGAGAAGAGATTCGACCACAGCAAGTTTGGGTGCTGCTAATTC
CGATCTTCCATCTCCACTCATGGATCTGAGTGACCTTATTACTTCCTTCTCAAATAAAGGGTTCACTGCCAAAGAAATGGTTGCTCTCTCAG
AGGTAAAATAAAATTAAGGGAAATCATC
GCCACAATTAAATAAGGATCTTGTACCAATTGACTTCGGTTTTGAAATTTTCTATAATCTTGTAGGATCTCACACAATAGGGCAAGCCAGGTGCCTGCTGTTTCGAAACCGTGTCTACAA
TGAGACCAGCCTAGATTCAACCTTGGCAACATCATTAAAATCAAATTGTCCAAACACAGGCAGTGATGACAGCCTTTCTTCACTGGATGCTACTACTCCTGTCACATTTGATAACTCTTA
TTTCAAGAACCTGGCAAACAACAAGGGCCTTTTGCACTCGGATCAACAGCTTTTCAGTGGAGGCACTACGGACTCGCAGGTCAAGACATACAGCATCAATTCTGCTACATTCTATGCTGA
TTTTGCTAGTGCCATGGTAAAGATGGGTAGCATTAGCCCCCTAACAGGAAGCGATGGACAGATTCGTACCAACTGCGCCAAAGTAAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGTAGACGGTCCAGACCAAATGCTTCCTATAAATAGGCCTCCTCTACAGCACTTACATGCCATCGATCAAACACAAGAGATATATCACAAGTTCAACTATATCCCTCTGTGTCTTTAC
ATTTTGGATTATATGGCTCTCTCAAAAATTTTCTACGGGTTATGTTTCTCTATGCTTTTGCTTGGATTAGTCCATGCACAGTTATCAACCACTTTCTATGCAACAACATGCCCTAAAGCC
CTCTCTACCATCAGAACTGCTGTACTAAAAGCAGTTGTCAAGGAGCATCGCATGGGAGCCTCCTTGCTCCGTCTCCATTTCCATGACTGCTTCGTTAAT
GGATGTGATGCATCAGTCCTA
TTAGATGACACTTCAAGTTTTACTGGAGAAAAGACTGCAGGCCCAAATGCAAATTCTTTGAGAGGTTATGATGTGATTGATACCATTAAGTCTCAATTGGAGTCAATTTGCCCTGGAGTT
GTTTCTTGTGCTGATATTCTGGCTGTTGCTGCTCGAGATTCAGTTGTTGCA
TTGAGTGGACCTTCATGGACAGTTCAATTGGGGAGAAGAGATTCGACCACAGCAAGTTTGGGTGCTGCT
AATTCCGATCTTCCATCTCCACTCATGGATCTGAGTGACCTTATTACTTCCTTCTCAAATAAAGGGTTCACTGCCAAAGAAATGGTTGCTCTCTCAG
GATCTCACACAATAGGGCAAGCC
AGGTGCCTGCTGTTTCGAAACCGTGTCTACAATGAGACCAGCCTAGATTCAACCTTGGCAACATCATTAAAATCAAATTGTCCAAACACAGGCAGTGATGACAGCCTTTCTTCACTGGAT
GCTACTACTCCTGTCACATTTGATAACTCTTATTTCAAGAACCTGGCAAACAACAAGGGCCTTTTGCACTCGGATCAACAGCTTTTCAGTGGAGGCACTACGGACTCGCAGGTCAAGACA
TACAGCATCAATTCTGCTACATTCTATGCTGATTTTGCTAGTGCCATGGTAAAGATGGGTAGCATTAGCCCCCTAACAGGAAGCGATGGACAGATTCGTACCAACTGCGCCAAAGTAAAC
TGA

Retrieve as FASTA