Entry information : PtPrx50 (POPTR_0018s13150 / PT18G11160 / Potri.018G131600)
Entry ID 3140
Creation 2006-06-14 (Claudia Cosio)
Last sequence changes 2010-08-02 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx50 (POPTR_0018s13150 / PT18G11160 / Potri.018G131600)
Name (synonym) PtPrx50 (POPTR_0018s13150 / PT18G11160 / Potri.018G131600)
Class Class III peroxidase    [Orthogroup: Prx007]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx50
start..stop
S start..stop
PtPrx78 613 0 1..323 1..321
RcPrx09 550 0 1..323 1..321
CclPrx45 528 0 1..323 1..322
PpePrx26 526 0 1..323 1..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 13596137..13596337 201 N° 2 13596430..13596612 183 N° 3 13596710..13596875 166 N° 4 13597015..13597436 422
join(13596137..13596337,13596430..13596612,13596710..13596875,13597015..13597436 )


exon

Literature and cross-references PtPrx50 (POPTR_0018s13150 / PT18G11160 / Potri.018G131600)
DNA ref. Phytozome 12:   scaffold_18 (13596137..13597436)
Omic ref. ePlant:   Potri.018G131600
Protein sequence: PtPrx50 (POPTR_0018s13150 / PT18G11160 / Potri.018G131600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (303)
PWM (Da):   %s   35057.74 (32855.6)  
PI (pH):   %s   6.77 (7.41) Peptide Signal:   %s   cut: 21 range:21-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEGLWLVVLVVFVMALSVESQLKTGFYSSSCPKAEAIVRSTVESYFKKDPTIAAGLLRLHFHDCFVQGCDGSVLIAGRSSAERNALPNLGLRGFEVIDDAKSQIEASCPGVVSCADILALAARDAVDLSDGPSWSVSTGRRDGRVSLSSQVSKYLPSPLDSIAVQKQKFADKGLDDHDLVTLVGAHTLGQTHCQFIRYRLYNFTATGNADPTINQSFLSQLRALCPNNGDGTIPVPLDKDSQTDFDTSFFKNVRDGNGVLESDQRLWDDAATRDVVKKYAGTIRGLLGHRFDIEFRQAMVKMSSIDVKTGTNGEIRKACSKFN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 18, 3 introns). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGGGTTATGGCTGGTTGTTCTGGTGGTTTTTGTTATGGCTTTGTCTGTGGAAAGCCAATTGAAAACAGGGTTTTATTCTTCTTCATGTCCGAAAGCTGAGGCCATAGTTAGGTCC
ACAGTTGAATCATACTTCAAGAAAGATCCTACCATTGCAGCAGGATTGCTCAGGCTTCATTTTCACGACTGCTTTGTTCAG
GTCTTGACCTATTTATTCTCCACTCTATCCTTTAGCATA
TTTTAAACGCAAGATAATGATCAGTGCTATGGACTAACATGAATCTTATACAGGGCTGTGATGGTTCAGTGTTAATTGCAGGCCGGTCTTCTGCTGAGAGAAATGCGTTGCCAAATCTAG
GATTAAGAGGGTTTGAAGTAATTGATGATGCCAAATCACAGATAGAGGCCTCATGCCCTGGCGTGGTCTCGTGTGCTGATATACTAGCATTGGCTGCTCGTGATGCTGTGGACTTG
GTAA
ATGATCTCTTCGCCCTCAATTTCCAATGCATGAATAAAATTAAAGAGCAAGAAATATATTCTTATGCATCGTGTGTTTGTTATAAAATCTCAGAGTGATGGTCCAAGTTGGTCAGTCTCA
ACAGGTAGAAGAGATGGCAGAGTCTCTTTATCATCCCAGGTCTCAAAATATTTACCTTCTCCTCTAGACTCCATTGCGGTCCAGAAGCAAAAATTTGCTGATAAAGGCCTTGACGATCAC
GATCTCGTAACTCTCGTTG
GTATAAATTTATTTCTTTCCCATTCCAAGTTAGCATTCGTTTACTTTCTTGAAACATAAGAAATGGAGACGAACGAAAATAGAGGAGATATATCTCCATTT
ACCTCATATTAGCATTCGGTAACTTGTTTCTGTTTCAGGAGCACATACCCTAGGCCAAACACACTGCCAGTTCATACGGTATCGCCTATATAATTTCACAGCAACAGGAAATGCAGATCC
AACTATAAACCAATCATTCCTATCACAACTTCGAGCTCTGTGCCCCAACAACGGTGATGGCACAATACCAGTTCCATTAGATAAAGATAGCCAGACAGATTTTGATACAAGCTTCTTTAA
GAACGTACGTGATGGTAATGGAGTTTTGGAGTCTGACCAGAGACTTTGGGATGATGCTGCAACACGAGATGTTGTGAAAAAATATGCCGGCACCATAAGAGGACTTTTGGGACATAGGTT
TGACATTGAGTTCAGGCAAGCCATGGTTAAAATGAGTAGCATTGACGTGAAAACTGGGACAAATGGAGAGATTAGAAAAGCTTGTTCAAAGTTCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAAGGGTTATGGCTGGTTGTTCTGGTGGTTTTTGTTATGGCTTTGTCTGTGGAAAGCCAATTGAAAACAGGGTTTTATTCTTCTTCATGTCCGAAAGCTGAGGCCATAGTTAGGTCC
ACAGTTGAATCATACTTCAAGAAAGATCCTACCATTGCAGCAGGATTGCTCAGGCTTCATTTTCACGACTGCTTTGTTCAG
GGCTGTGATGGTTCAGTGTTAATTGCAGGCCGGTCTTCT
GCTGAGAGAAATGCGTTGCCAAATCTAGGATTAAGAGGGTTTGAAGTAATTGATGATGCCAAATCACAGATAGAGGCCTCATGCCCTGGCGTGGTCTCGTGTGCTGATATACTAGCATTG
GCTGCTCGTGATGCTGTGGACTTG
AGTGATGGTCCAAGTTGGTCAGTCTCAACAGGTAGAAGAGATGGCAGAGTCTCTTTATCATCCCAGGTCTCAAAATATTTACCTTCTCCTCTAGAC
TCCATTGCGGTCCAGAAGCAAAAATTTGCTGATAAAGGCCTTGACGATCACGATCTCGTAACTCTCGTTG
GAGCACATACCCTAGGCCAAACACACTGCCAGTTCATACGGTATCGCCTA
TATAATTTCACAGCAACAGGAAATGCAGATCCAACTATAAACCAATCATTCCTATCACAACTTCGAGCTCTGTGCCCCAACAACGGTGATGGCACAATACCAGTTCCATTAGATAAAGAT
AGCCAGACAGATTTTGATACAAGCTTCTTTAAGAACGTACGTGATGGTAATGGAGTTTTGGAGTCTGACCAGAGACTTTGGGATGATGCTGCAACACGAGATGTTGTGAAAAAATATGCC
GGCACCATAAGAGGACTTTTGGGACATAGGTTTGACATTGAGTTCAGGCAAGCCATGGTTAAAATGAGTAGCATTGACGTGAAAACTGGGACAAATGGAGAGATTAGAAAAGCTTGTTCA
AAGTTCAATTAA

Retrieve as FASTA