Entry information : PtPrx56 (POPTR_0005s21740 / PT05G10420 / Potri.005G195600)
Entry ID 3146
Creation 2010-01-18 (Christophe Dunand)
Last sequence changes 2010-06-22 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx56 (POPTR_0005s21740 / PT05G10420 / Potri.005G195600)
Name (synonym) PtPrx56 (POPTR_0005s21740 / PT05G10420 / Potri.005G195600)
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Buds
Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx56
start..stop
S start..stop
PtralPrx03 666 0 1..349 1..349
PtrePrx04 666 0 22..349 24..351
PtPrx67 628 0 1..354 1..354
PtPrx57 547 0 1..353 1..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20845212..20845460 249 N° 2 20845573..20845767 195 N° 3 20847168..20847788 621  
join(20845212..20845460,20845573..20845767,20847168..20847788)


exon

Literature and cross-references PtPrx56 (POPTR_0005s21740 / PT05G10420 / Potri.005G195600)
Literature Ralph,S., Oddy,C., Cooper,D., Yueh,H., Jancsik,S., Kolosova,N., Philippe,R.N., Aeschliman,D., White,R., Huber,D., Ritland,C.E., Benoit,F., Rigby,T., Nantel,A., Butterfield,Y.S.N., Kirkpatrick,R., Chun,E., Liu,J., Palmquist,D., Wynhoven,B., Stott,J., Yang,G.,Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Ellis,B.E., Douglas,C.J., Ritland,K. and Bohlmann,J. Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   scaffold_5 (20845212..20847788)
Cluster/Prediction ref. UniGene:   Pth.10738
Omic ref. ePlant:   Potri.005G195600
Protein sequence: PtPrx56 (POPTR_0005s21740 / PT05G10420 / Potri.005G195600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (326)
PWM (Da):   %s   38746.52 (35727.0)  
PI (pH):   %s   5.78 (5.77) Peptide Signal:   %s   cut: 29 range:29-354
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARAAMSFTSLLLISSLFLASWFCATEAQGTIPIENGLSWTFYKSKCPKVESIIRKQLGKVFKKDIEQAAGLLRLHFHDCFVQGCDGSVLLDGSASGPSEQDAPPNLTLRAKAFEIIEDLRRRVEKACGLVVSCSDILALAARDSVYLSGGPDYNVPLGRRDGLKFATQNETLDNLPPPFANADTILSSLATKGFDATDVVALSGGHTIGISHCSSFTDRLYPTQDPTMDKTFANNLKEVCPTRDFNNTTVLDIRSPNKFDNKYYVDLMNRQGLFTSDQDLYTNKKTRGIVTSFAVNQSLFFDKFVVAMIKMSQLKVLTGNQGEIRASCEERNSGYSYLESVVEEGLDALSGLI*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2) and 22 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGAGCTGCTATGTCCTTTACCTCTCTTCTTCTGATTTCTTCTCTCTTTCTAGCTTCTTGGTTTTGTGCCACTGAAGCACAAGGCACCATCCCTATAGAGAATGGCCTGTCATGG
ACATTCTACAAGTCTAAATGCCCTAAAGTTGAATCCATTATAAGGAAACAGCTGGGAAAGGTGTTCAAGAAGGATATCGAACAAGCTGCTGGCTTGCTTCGTCTCCACTTCCATGATTGC
TTTGTTCAG
GTTACAGGATATTTCATATATTCAAAACTCATCTTGGCATTTACTATTTTGTTCAGTTGCGAAGTTCACTATTTTTGATCAATGAATTAATATCTAAAAATTAACTCTGCA
GGGATGTGATGGTTCGGTATTGCTTGATGGATCGGCGAGTGGTCCAAGCGAGCAGGACGCCCCTCCCAACCTGACCTTGAGAGCAAAGGCGTTTGAGATCATCGAAGACCTACGCCGGCG
CGTGGAAAAGGCTTGCGGCCTTGTCGTCTCCTGTTCTGATATTCTTGCGCTTGCAGCCCGTGACTCTGTTTACCTG
GTGAGTCGACTTGAATCACTCTCTGTTATCGTAGTTTTTGATAA
TGATCCTAGCTAGCTAGCATGGAGCACATGATTTAATACCATCTCCTGTATCGTTAGATACACATCCGTATATAGTCCAGCCATATTCTTGAGAGTCGAGTCTAAATCGAGATTTTTTTT
TTTAAAAATAGTTTTTTTCCATATTTTTTTTTGAAAAAGTAGAGTAATTGATTTTTTTCCCCAAAAAATAGCACACTTAATAAATTAATTTGAAAACAATGTAATTAATTATCTTTCTTT
AGGAAATATAGGAATGAGATTTGGGTTCATTGATTTTAATAATACTATTAAAAATTAGCCTAATTATGGCTCTTGTTAGATGTTAAGTAACTTATTTTTATAACATAAAAATAATATATT
GAGAAATTAAACGTTCAGTATAAAGCTTAGATTTTTAAAATAAAATTGAATTTTAATTATCGAAATTTATTATGGTATTTCAGGAATAAGTGTTAAATAATTAATTGCACATGAAATAAT
TACAAATAGAAGATTACGAGTAAGTCAAGTCTTTCTGTCCCCCATATAATATATGTCCTGCAACTAGGGGCATAAAATGTGACTGATAAGACCAGATAAGCTTATCCAATGTTATTTTCA
GAGCTTAGATATCCGCCTGTCGATTTCTATCCAGTTAGTTGATCAGTGATTGCGAGAGGCAAATTAATTCCTCATAATCTTTTAAAATCCTATTAATTCTCGTTTGGTTCTGTATTTTAA
AAACATTTTTAAAATTTTTTTTTTTTTTTTATTTTAAATTAATATTTTTTTAGTATTTTCCGTTTATTTTGATGGATTGATGTTAAAAATAATTTTTAACAAATAAAAATAATAATTTTT
TAATACTTTTTTAAGTGAAAAACAATCATACTCTCAAACACACTAAATATTATAATTAGTAGCGATTGTTTATTTAAATATTTTTTACTTAAAAATATATTAAAATAATATTTTTTTAAA
TTTATTTTGACTTTAATATTAATATATTAAAATAATCTAAAAATACTTAAAAAAAAATATTAATATATTAAAATAATCTAAAAATACTTAAAAAAAAATACTCTTTCCCAGCAAAATTAT
TATTATGACTTTCTTGTGACTTGTCATGATCATTAAACACATATAAAGGGTGTGTATATGCATGCCTCCTTGAGTTCTGCTTTTTTATTTTCAAATTAAGTTTTAGATATTTTTATGTTG
ATAATAATTTTTTTATTCTTTTTTTTTTTAAAAAAACATTTTGTATCACATTCTCCGTGTGTGTGTAATGAATCAATAAAATTTCTTTCGGTAACAAGTCATTACTCATAACCAAAGCTA
ATCCTTTTTAACTTCTATGCATTTTTTCTACTGCAGTCTGGTGGCCCAGATTATAATGTTCCCTTGGGAAGGCGAGACGGTCTAAAATTTGCAACTCAAAATGAAACCTTAGACAACCTC
CCGCCACCCTTTGCTAACGCCGACACAATTCTCTCATCTCTCGCCACCAAGGGCTTCGATGCCACCGACGTGGTAGCCCTGTCCGGTGGCCACACCATCGGTATAAGTCACTGCAGCTCT
TTCACTGACCGCCTCTATCCAACCCAAGATCCTACAATGGACAAAACCTTTGCCAACAATCTCAAGGAAGTTTGCCCCACAAGAGACTTCAATAACACAACCGTGTTGGATATTCGATCT
CCTAATAAATTTGACAACAAGTACTATGTTGATCTCATGAATCGCCAAGGCCTGTTTACTTCAGACCAGGACTTGTACACGAACAAGAAGACAAGGGGCATTGTCACTAGCTTTGCTGTT
AATCAAAGTTTGTTCTTTGATAAGTTTGTGGTTGCAATGATCAAAATGTCACAGCTCAAGGTCTTGACAGGAAATCAAGGTGAAATCCGCGCCAGTTGCGAGGAGAGAAATTCAGGCTAC
AGTTACTTGGAGTCTGTGGTGGAAGAGGGTCTCGACGCACTGTCCGGATTAATATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGAGCTGCTATGTCCTTTACCTCTCTTCTTCTGATTTCTTCTCTCTTTCTAGCTTCTTGGTTTTGTGCCACTGAAGCACAAGGCACCATCCCTATAGAGAATGGCCTGTCATGG
ACATTCTACAAGTCTAAATGCCCTAAAGTTGAATCCATTATAAGGAAACAGCTGGGAAAGGTGTTCAAGAAGGATATCGAACAAGCTGCTGGCTTGCTTCGTCTCCACTTCCATGATTGC
TTTGTTCAG
GGATGTGATGGTTCGGTATTGCTTGATGGATCGGCGAGTGGTCCAAGCGAGCAGGACGCCCCTCCCAACCTGACCTTGAGAGCAAAGGCGTTTGAGATCATCGAAGACCTA
CGCCGGCGCGTGGAAAAGGCTTGCGGCCTTGTCGTCTCCTGTTCTGATATTCTTGCGCTTGCAGCCCGTGACTCTGTTTACCTG
TCTGGTGGCCCAGATTATAATGTTCCCTTGGGAAGG
CGAGACGGTCTAAAATTTGCAACTCAAAATGAAACCTTAGACAACCTCCCGCCACCCTTTGCTAACGCCGACACAATTCTCTCATCTCTCGCCACCAAGGGCTTCGATGCCACCGACGTG
GTAGCCCTGTCCGGTGGCCACACCATCGGTATAAGTCACTGCAGCTCTTTCACTGACCGCCTCTATCCAACCCAAGATCCTACAATGGACAAAACCTTTGCCAACAATCTCAAGGAAGTT
TGCCCCACAAGAGACTTCAATAACACAACCGTGTTGGATATTCGATCTCCTAATAAATTTGACAACAAGTACTATGTTGATCTCATGAATCGCCAAGGCCTGTTTACTTCAGACCAGGAC
TTGTACACGAACAAGAAGACAAGGGGCATTGTCACTAGCTTTGCTGTTAATCAAAGTTTGTTCTTTGATAAGTTTGTGGTTGCAATGATCAAAATGTCACAGCTCAAGGTCTTGACAGGA
AATCAAGGTGAAATCCGCGCCAGTTGCGAGGAGAGAAATTCAGGCTACAGTTACTTGGAGTCTGTGGTGGAAGAGGGTCTCGACGCACTGTCCGGATTAATATGA

Retrieve as FASTA