Entry information : PtPrx65 (POPTR_0002s01960 / Potri.002G018000)
Entry ID 3155
Creation 2006-06-22 (Claudia Cosio)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx65 (POPTR_0002s01960 / Potri.002G018000)
Name (synonym) PtPrx65 (POPTR_0002s01960 / Potri.002G018000)
Class Class III peroxidase    [Orthogroup: Prx015]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type Flowers
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx65
start..stop
S start..stop
CpapPrx26 561 0 6..317 11..322
CsPrx27 555 0 1..316 1..316
CclPrx51 550 0 1..316 1..316
MePrx114 544 0 14..316 16..319
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx65 (POPTR_0002s01960 / Potri.002G018000)
Literature Sterky,F., Bhalerao,R.R., Unneberg,P., Segerman,B., Nilsson,P., Brunner,A.M., Charbonnel-Campaa,L., Lindvall,J.J., Tandre,K., Strauss,S.H., Sundberg,B., Gustafsson,P., Uhlen,M., Bhalerao,R.P., Nilsson,O., Sandberg,G., Karlsson,J., Lundeberg,J. and Jansson,S. A Populus EST resource for plant functional genomics. Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13951-13956 (2004).
DNA ref. Phytozome 12:   Chr02 (1044561..1045822)
Omic ref. ePlant:   Potri.002G018000
Protein sequence: PtPrx65 (POPTR_0002s01960 / Potri.002G018000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   33841.21 (31576.0) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.28 (9.28) Peptide Signal:   %s   cut: 24 range:24-317
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAAAGLVFALLVIFQMSSSVSALSSNYYEQTCPKLESAVTNAVK
KAMMNDKTVPAALLRMQFHDCFIR
GCDASVLLASKGKNKAEKDGPPNISLHAFYVIDNAKKAVEALCPGVVSCADILALAARDAVALSGGPTWDVPKGRKDGRISKASETRQLPAPTFNISQLQQSFSQRGLSLKDLVALSGGH
TLGFSHCSSFQNRIHSFNATLDVDPTLNPSFGSSLRSVCPAHNKVKNAGATMDSSTTTFDNVYYKLLLQGNSLFSSDQALLSTRETKALVSKFASSQEMFEKAFVKSMIKMSSISGGQEI
RLDCKVVR

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns)(DOE joint genome institute contig 16 from LG-II) and 3 ESTs (DN490972, DN500980, BU880295).
DNA
Send to BLAST
CDS
Send to BLAST