Entry information : PtPrx66 (POPTR_0002s03260 / Potri.002G031200)
Entry ID 3156
Creation 2006-06-13 (Claudia Cosio)
Last sequence changes 2012-03-08 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-07 (Qiang Li)
Peroxidase information: PtPrx66 (POPTR_0002s03260 / Potri.002G031200)
Name (synonym) PtPrx66 (POPTR_0002s03260 / Potri.002G031200)
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx66
start..stop
S start..stop
VvPrx89 557 0 1..345 1..352
RcPrx73 543 0 1..345 1..344
TsPrx09 536 0 1..345 1..352
AcoPrx01 537 0 43..345 160..462
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2006120..2006386 267 N° 2 2006550..2006742 193 N° 3 2006856..2007022 167 N° 4 2007126..2007537 412
join(2006120..2006386,2006550..2006742,2006856..2007022,2007126..2007537)


exon

Literature and cross-references PtPrx66 (POPTR_0002s03260 / Potri.002G031200)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_2 (2006120..2007537)
Omic ref. ePlant:   Potri.002G031200
Protein sequence: PtPrx66 (POPTR_0002s03260 / Potri.002G031200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (321)
PWM (Da):   %s   37133.92 (34553.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.06 (8.89) Peptide Signal:   %s   cut: 25 range:25-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFSKASFSFIFMIVLLSSTTSLAHPGLGWGGKGGPFGGGSSGLFPGFYQYSCPQANDIVMSVLRKAIAKDSRMPASLLRLHFHDCFVQGCDASVLLDDSAKIVSEKNSGPNKNSLRGFEVVDEIKAKLEEACPQTVSCADILALAARGSTVLSGGPNWELPLGRRDSKTASLSGSNNSIPAPNSTIQNLISLFKRQGLNDIDLVALSGGHTIGVARCVTFKQRLYNQNGNNQPDHTIEKNYFLDLKSVCPKSGGDNNISPLDLASPAKFDNTYFKLLLWGKGLLTSDEVLYTGKVGKTTQLVKRYAEDEGRFFEHFAKSMVKMGSISPLTGFNGEVRKNCRLVN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTCTCTAAAGCGAGTTTTAGTTTCATTTTCATGATTGTTCTCCTCTCATCAACAACGAGCCTAGCTCATCCTGGTTTGGGCTGGGGTGGAAAGGGTGGTCCTTTTGGTGGTGGC
TCCTCTGGTCTGTTCCCTGGATTCTATCAGTATTCATGTCCTCAAGCTAATGACATTGTCATGTCAGTGTTAAGAAAAGCTATTGCAAAGGACTCCAGGATGCCTGCCTCTTTGCTAAGG
CTTCATTTTCATGATTGCTTTGTGCAG
GTCATACACCTGGTTTTGTATTTTTCTTCATCTTCTCTGCATTTTATCTTTGTTCTACGCATAATCTGTAACCATTTCTTTGAAGTGATCGCA
TCATATGGCCTTGAACAGACTTATAAGCAACGTATTGCTTGATTAAATTGTCATGTTATTGATCTTGCAGGGTTGTGATGCATCGGTATTGTTGGACGATAGTGCAAAGATAGTGAGTGA
GAAGAATTCTGGACCAAACAAGAATTCCCTCAGAGGATTTGAAGTGGTTGATGAAATCAAGGCTAAGTTGGAAGAAGCATGCCCTCAAACTGTCTCCTGCGCAGACATTCTCGCCTTGGC
AGCTCGTGGCTCAACTGTGCTAG
TAAGCAAAATCCAAAACCAAATTCTACCTTCTGAATTCTGAATTCTTGGCACCTTATGCCATTTATTAACCCATTTTTTTGCTAACAAAAAACCGGT
TGGTGTTTTGATTCAGAGCGGCGGGCCTAATTGGGAACTCCCATTAGGAAGAAGGGACTCAAAGACTGCGAGTCTGAGTGGCTCAAACAACAGCATCCCTGCACCCAACTCCACCATTCA
AAACCTCATATCACTTTTCAAGCGTCAAGGCCTTAATGATATTGACCTTGTTGCTCTCTCAGG
TTTGAACACAACACATCCTTCTGCGTATGTTAATATTTGTCACACCACATTATAACA
CAGATGGATCGTTTGATTATTAATTTGAAAACTGCCATGTTTCAGGAGGGCATACAATTGGGGTGGCAAGGTGTGTGACCTTCAAGCAGAGGCTATACAACCAAAATGGAAACAACCAGC
CAGATCATACTATAGAGAAAAACTATTTCTTAGATTTGAAGTCAGTGTGTCCAAAATCTGGAGGAGACAATAACATTTCTCCCTTGGACTTGGCCTCTCCAGCAAAATTTGACAACACTT
ACTTCAAGCTCTTACTTTGGGGCAAAGGGCTTCTCACTTCTGATGAAGTGCTTTATACAGGTAAAGTTGGCAAGACAACTCAGTTGGTTAAGAGATATGCTGAGGATGAGGGCCGGTTCT
TTGAGCATTTTGCCAAGTCTATGGTTAAGATGGGAAGCATTAGTCCTCTTACTGGTTTTAATGGTGAAGTTAGGAAGAACTGTCGCCTTGTTAATTAA

Retrieve as FASTA