Entry information : PtPrx68(POPTR_0013s08130 / Potri.013G083600)
Entry ID 3158
Creation 2006-06-22 (Claudia Cosio)
Last sequence changes 2006-06-22 (Catherine )
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2020-04-22 (Catherine )
Peroxidase information: PtPrx68(POPTR_0013s08130 / Potri.013G083600)
Name PtPrx68(POPTR_0013s08130 / Potri.013G083600)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx68
start..stop
S start..stop
PbPrx68 657 0 1..322 1..322
PatrPrx68 640 0 1..322 1..322
MePrx27 553 0 1..322 1..326
VvPrx76 533 0 1..322 1..321
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx68(POPTR_0013s08130 / Potri.013G083600)
Literature REFERENCE 1 Sterky,F., Bhalerao,R.R., Unneberg,P., Segerman,B., Nilsson,P., Brunner,A.M., Charbonnel-Campaa,L., Lindvall,J.J., Tandre,K., Strauss,S.H., Sundberg,B., Gustafsson,P., Uhlen,M., Bhalerao,R.P., Nilsson,O., Sandberg,G., Karlsson,J., Lundeberg,J. and Jansson,S. A Populus EST resource for plant functional genomics. Proc. Natl. Acad. Sci. U.S.A. 101 (38), 13951-13956 (2004).

REFERENCE 2 DOE joint genome institute.
DNA ref. Phytozome 12:   Chr13 (7763982..7762010)
EST ref. GenBank:   DN494839 [5' end]
Cluster/Prediction ref. UniGene:   Pth.12644
Omic ref. ePlant:   Potri.013G083600
Protein sequence: PtPrx68(POPTR_0013s08130 / Potri.013G083600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   322 (296)
PWM (Da):   %s   34766.44 (32125.1)  
PI (pH):   %s   9.14 (9.14) Peptide Signal:   %s   cut: 27 range:27-322
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSSSFSKAIVTLAILVMLSMGSSNAQLSIDFYSKSCPHLLSTVK
PVVQSAINKEARMGASILRLFFHDCFVN
GCDGSLLLDDTSSFTGEKNAAPNKNSARGFEVIDNIKSAVEKACPGVVSCADILAIAARDSTVILGGPEWDVKLGRRDARTASQAAANNSIPRPTSNLNQLISRFNALGLSTRDMVALSG
SHTIGQARCTNFRARIYNETTIDSSLAQTRRSNCPRTSGSGDNNLAPLDLQTPTRFENNYYKNLINRRGLLHSDQQLFNGGSTDSIVSTYSSNENTFRSDFVAGMIKMGDIRPLTGSRGE
IRNNCRRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns) and 3 ESTs.
DNA
Send to BLAST
CDS
Send to BLAST