Entry information : PtPrx75 (POPTR_0016s13280 / Potri.016G125000)
Entry ID 3170
Creation 2006-06-13 (Claudia Cosio)
Last sequence changes 2010-06-30 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx75 (POPTR_0016s13280 / Potri.016G125000)
Name (synonym) PtPrx75 (POPTR_0016s13280 / Potri.016G125000)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type Flower buds
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx75
start..stop
S start..stop
PalPrx08 613 0 2..306 20..324
RcPrx54 558 0 1..306 19..324
MePrx31 533 0 1..306 18..321
GhPrx06 526 0 1..306 23..328
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx75 (POPTR_0016s13280 / Potri.016G125000)
Literature Unneberg,P., Bhalerao,R.R., Jansson,S. and Sterky,F. The poplar tree transcriptome: Analysis of expressed sequence tags from multiple libraries Unpublished (2002).
DNA ref. Phytozome 12:   scaffold_16 (12486082..12484918)
EST ref. GenBank:   BU874958
Omic ref. ePlant:   Potri.016G125000
Protein sequence: PtPrx75 (POPTR_0016s13280 / Potri.016G125000)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   306
PWM (Da):   %s   32737.43 Transmb domain:   %s   o31-53i
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MVQGQGTRVGFYATTCRRAESIVRATVQSHFTSDSSIAPGLLRMHFHDCFVNGCDASILIDGANTEKTARPNLLLRGYDVIADAKTQLEAECPGVVSCADILALAARDSVVLTKGLTWPV
PTGRRDGRVSLASDTSNLPGFTDSVDVQKQKFAAFGLNAQDLVTLV
GGHTIGTTACQFFSYRLYNFTTTGNGADPSINPSFVSQLQTLCPQNGDGSRRIALDTGSQNRFDSSFFSNLRSG
QGILESDQKLWTDATTRTFVQRFLGVRGLAGLTFGAEFGRSMVKMSNIGVKTGTNGEIRRVCSAIN

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 2 and 3) and 1 EST.
DNA
Send to BLAST
CDS
Send to BLAST