Entry information : PtPrx79 (POPTR_0006s28320 / Potri.006G267400)
Entry ID 3174
Creation 2006-06-07 (Claudia Cosio)
Last sequence changes 2006-06-07 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx79 (POPTR_0006s28320 / Potri.006G267400)
Name (synonym) PtPrx79 (POPTR_0006s28320 / Potri.006G267400)
Class Class III peroxidase    [Orthogroup: Prx026]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue types Leaves
Stems
Inducers Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx79
start..stop
S start..stop
PtPrx52 622 0 1..332 1..334
MePrx17 512 0 1..332 3..334
RcPrx44 508 0 1..332 1..327
CsPrx39 503 0 17..332 18..333
Gene structure Fichier Exons


exon

Literature and cross-references PtPrx79 (POPTR_0006s28320 / Potri.006G267400)
Literature Ralph,S., Oddy,C., Cooper,D., Yueh,H., Jancsik,S., Kolosova,N., Philippe,R.N., Aeschliman,D., White,R., Huber,D., Ritland,C.E., Benoit,F., Rigby,T., Nantel,A., Butterfield,Y.S.N., Kirkpatrick,R., Chun,E., Liu,J., Palmquist,D., Wynhoven,B., Stott,J., Yang,G.,Barber,S., Holt,R., Siddiqui,A., Jones,S., Marra,M., Ellis,B.E., Douglas,C.J., Ritland,K. and Bohlmann,J. Genomics of hybrid poplar (Populus trichocarpax deltoides) interacting with forest tent caterpillars (Malacosoma disstria): normalized and full-length cDNA libraries, expressed sequence tags, and a cDNA microarray for the study of insect-induced defences Mol. Ecol. 15 (5), 1275-1297 (2006).
DNA ref. Phytozome 12:   scaffold_6 (26036211..26034413)
EST ref. GenBank:   CV245011
Omic ref. ePlant:   Potri.006G267400
Protein sequence: PtPrx79 (POPTR_0006s28320 / Potri.006G267400)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332
PWM (Da):   %s   35795.79 Transmb domain:   %s   i13-35o
PI (pH):   %s   5.02
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METTSVPFSARPHLCSFLALVLLYVVSSPCFASLFFNFYGASCPAAELIVSNKVRSASSSDPTIPGKLVRLVFHDCFVEGCDASVLLQGNGTERSDPGNRSLGGFQVIDSAKRNLEIFCP
GTVSCADVVALAARDAVAI
SGGPQLQIPTGRRDGRVSAAANVRPNIIDTTFTMNEMISIFTAKGLSLEDLVVLSGAHTIGSAHCSAFRDRFQENSKGKLTLIDSSLDKNYANELTQRCPV
DASDSITVVNDPETSLSFDNQYYRNLVAHKGLFQSDSVLLDDNRTRNLVEDLANDQGRFFESWSQSFLKLTSIGVKTGEEGEIRQSCSMTNG

Retrieve as FASTA  
Remarks From gen.omic DNA (3 introns, contig 289 from LG-VI). Splicing predicted by the PeroxiBase team with FGeneSH. 2 ESTs (NCBI CV245011, CV240959)
DNA
Send to BLAST
CDS
Send to BLAST