Entry information : PtPrx82 (POPTR_0017s09640 / Potri.017G064100)
Entry ID 3177
Creation 2008-08-18 (Christophe Dunand)
Last sequence changes 2010-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx82 (POPTR_0017s09640 / Potri.017G064100)
Name (synonym) PtPrx82 (POPTR_0017s09640 / Potri.017G064100)
Class Class III peroxidase    [Orthogroup: Prx027]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx82
start..stop
S start..stop
PtPrx21 557 0 16..323 18..325
MePrx64 551 0 2..323 4..324
VvPrx65 541 0 1..323 1..323
RcPrx76 531 0 17..323 24..330
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8303830..8304033 204 N° 2 8305109..8305300 192 N° 3 8305400..8305975 576  
join(8303830..8304033,8305109..8305300,8305400..8305975)


exon

Literature and cross-references PtPrx82 (POPTR_0017s09640 / Potri.017G064100)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_17 (8303830..8305975)
Cluster/Prediction ref. JGI gene:   742840
Omic ref. ePlant:   Potri.017G064100
Protein sequence: PtPrx82 (POPTR_0017s09640 / Potri.017G064100)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (302)
PWM (Da):   %s   34447.07 (32162.8)  
PI (pH):   %s   4.96 (4.92) Peptide Signal:   %s   cut: 22 range:22-323
Sequence 364
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MERGYMLLLVVLIIAIGRGEGQLVENFYSSSCPNVEGIVRQAVSTKFRQTFTTIPATLRLFFHDCFVTGCDASTMVSSPNGDAEKDAPDNLSLAGDGFDTVVKAKQAVEAACPKVVSCADILALAARDVVVLAGGPSFNVELGRRDGMVSQASLVKGNLPDPDFTLSQLNAMFAKNNLNQIDMIALSGAHTLGFSHCNRFAKRLYSFSSSSPVDPSLDAEYAQQLMNACPRNVDPSIAIDMDPVTSRTFDNVYFQNLVSGKGLFTSDEVLFSDPASQPTVNDFAKNSGDFNGAFATAMRKLGRVGVKTGSQGTIRTDCTVINS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 17, introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAGAGGTTATATGCTTCTGCTGGTGGTTTTGATCATTGCCATAGGAAGGGGAGAGGGACAACTAGTGGAAAACTTCTACAGCTCTAGCTGTCCTAACGTGGAAGGTATAGTGAGGC
AGGCTGTTTCCACAAAGTTCAGGCAGACATTCACTACAATCCCAGCAACTCTTCGTCTGTTTTTTCATGACTGCTTTGTGACG
GTACTATATTGATCGTTCTTTTTGTTACTACATATGC
ACTTATCAATTATTCATTCTTCACATCCATGAATGCCAGCTACTGATCATAGTGCCTTTTAACTGCATGCCCAAGTCCCATAAATGATCATCATGGAGCGTAGTTCAACAAGCAATACAT
AATATACTGGATGTTAAGAGGGAAAGTAGTCTTCTTTGATTGGACAAGGAGACTTTTGTTCCTAGTTTTGGTTGTGTTTTTATTTCTTATCTTTTCTTCCCTGGATATATGAACATGCTT
TTGGTTTCTGGGCTGTTGGGTTATGTATGGGAAATTATTGGTCACGATTGGAGGTTAGTATCTGATACAGCCATTGAATAAAAAACTAATAGAAACAAATACAAGTTATATTGCATAGGC
ACGTAGTATTTTTCAACAACTGCATTGATTTGGAACCAACAATCGTAGCAGATCAAGACCCGCTTGAAAGTGTAGTAAATATTGCATCGCTTGTGACCGCCAAACACACCCTAAGGGTGC
CGGTCAAACATGTATTTATTATTGACTCTTGTTAATCTCATTGATGGAATTGAAGCATTTTTGTCGACGGTCACCATGACATCATGTGTGGAAAGTCTATTGTACCCTCAGGCATCATTT
CATGGTAAACTGTTGAATAGTTTGTCCCAAAACTGCGATCACTTCTATATTTGTCTTGTTTTTGCTCTTTACAGGAGGCCTAATGGTAATTAATAATCAGGAAAATTCAACTGGATTGTC
GCATGTTGCAACATTTCTCTCAATTCCTCAAACAAATTAAAGCAAGTATAGGTGTCACATAGTATTCACGCATGGCCAAACAGACACCAAGCTATACTAAATTCAAGGTATCAAACTAGG
AATATTAGTGGTTGAACAGAGGCAATACCTCCTCTGTTTTGGTCCCTGAATTACAATCTGCACATTCTTTCACAATCCCAGTATGAAAATAACTTAAAACCACTTTAAATGATTAGGGGA
CATTTTGAATTGATTTTGAGCGATATACTGCTTGACTTTTATGCTCATAAAGCGTGTACTTCCTATTTGAAATCATAGGGTTGTGATGCTTCCACCATGGTTTCTTCACCAAATGGAGAC
GCAGAGAAGGACGCTCCAGACAATCTTTCTCTAGCAGGAGATGGATTCGATACCGTAGTGAAGGCAAAACAAGCAGTGGAAGCAGCTTGCCCCAAAGTAGTCTCCTGTGCAGACATTTTA
GCATTAGCTGCTAGGGATGTTGTTGTCCTG
GTAAGAAATTCACAAGCCAGCACAAGTTCTTAATTATAGTATTTCTATTTCGAAGGAGAAACTAACTTAATCTCTGGGTTTGATATGATC
AAAACTCAGGCTGGAGGTCCTTCATTCAACGTAGAATTAGGACGTCGTGATGGCATGGTTTCTCAAGCATCACTTGTGAAAGGAAATTTACCAGATCCCGACTTCACTCTTTCTCAACTT
AACGCTATGTTTGCTAAAAACAACCTTAACCAGATTGATATGATTGCACTATCAGGAGCCCACACACTAGGCTTCTCCCACTGCAACCGCTTTGCGAAGAGACTCTACTCTTTTTCCTCG
TCCTCTCCCGTTGACCCTTCTCTAGACGCAGAGTATGCCCAGCAGTTGATGAATGCCTGTCCTAGAAATGTAGACCCCAGCATAGCCATTGACATGGACCCTGTAACCTCACGAACCTTT
GACAATGTGTATTTCCAAAATCTGGTTTCTGGTAAAGGATTGTTCACTTCAGATGAAGTGCTGTTTAGCGATCCAGCTTCTCAGCCAACTGTCAATGATTTTGCTAAGAACTCGGGCGAT
TTTAATGGAGCTTTTGCGACTGCTATGAGAAAGCTTGGAAGGGTTGGAGTTAAGACAGGTAGCCAAGGAACGATCAGGACAGACTGTACAGTCATTAATTCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAGAGGTTATATGCTTCTGCTGGTGGTTTTGATCATTGCCATAGGAAGGGGAGAGGGACAACTAGTGGAAAACTTCTACAGCTCTAGCTGTCCTAACGTGGAAGGTATAGTGAGGC
AGGCTGTTTCCACAAAGTTCAGGCAGACATTCACTACAATCCCAGCAACTCTTCGTCTGTTTTTTCATGACTGCTTTGTGACG
GGTTGTGATGCTTCCACCATGGTTTCTTCACCAAATG
GAGACGCAGAGAAGGACGCTCCAGACAATCTTTCTCTAGCAGGAGATGGATTCGATACCGTAGTGAAGGCAAAACAAGCAGTGGAAGCAGCTTGCCCCAAAGTAGTCTCCTGTGCAGACA
TTTTAGCATTAGCTGCTAGGGATGTTGTTGTCCTG
GCTGGAGGTCCTTCATTCAACGTAGAATTAGGACGTCGTGATGGCATGGTTTCTCAAGCATCACTTGTGAAAGGAAATTTACCAG
ATCCCGACTTCACTCTTTCTCAACTTAACGCTATGTTTGCTAAAAACAACCTTAACCAGATTGATATGATTGCACTATCAGGAGCCCACACACTAGGCTTCTCCCACTGCAACCGCTTTG
CGAAGAGACTCTACTCTTTTTCCTCGTCCTCTCCCGTTGACCCTTCTCTAGACGCAGAGTATGCCCAGCAGTTGATGAATGCCTGTCCTAGAAATGTAGACCCCAGCATAGCCATTGACA
TGGACCCTGTAACCTCACGAACCTTTGACAATGTGTATTTCCAAAATCTGGTTTCTGGTAAAGGATTGTTCACTTCAGATGAAGTGCTGTTTAGCGATCCAGCTTCTCAGCCAACTGTCA
ATGATTTTGCTAAGAACTCGGGCGATTTTAATGGAGCTTTTGCGACTGCTATGAGAAAGCTTGGAAGGGTTGGAGTTAAGACAGGTAGCCAAGGAACGATCAGGACAGACTGTACAGTCA
TTAATTCTTGA

Retrieve as FASTA