Entry information : PtPrx88 (POPTR_0015s12170 / Potri.015G110200)
Entry ID 3205
Creation 2006-06-12 (Claudia Cosio)
Last sequence changes 2010-06-18 (Christophe Dunand)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx88 (POPTR_0015s12170 / Potri.015G110200)
Name (synonym) PtPrx88 (POPTR_0015s12170 / Potri.015G110200)
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx88
start..stop
S start..stop
MePrx68 501 0 19..323 21..325
RcPrx68 499 4.76e-180 18..323 20..325
LuPrx179 464 3.63e-166 1..324 2..326
LuPrx213 464 4.02e-166 22..324 24..327
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3205' 'join(12554750..12554971,12555407..12555586,12555666..12556238)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 12554750..12554971 220 N° 2 12555407..12555586 178 N° 3 12555666..12556238 571  
join(12554750..12554971,12555407..12555586,12555666..12556238)


exon

Literature and cross-references PtPrx88 (POPTR_0015s12170 / Potri.015G110200)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   scaffold_15 (12554750..12556238)
Cluster/Prediction ref. JGI gene:   575500
Omic ref. ePlant:   Potri.015G110200
Protein sequence: PtPrx88 (POPTR_0015s12170 / Potri.015G110200)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324
PWM (Da):   %s   34366.42 Transmb domain:   %s   i7-29o
PI (pH):   %s   5.7
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAEAAFLTLALGFISVNFTGFCFGALQVGFYRGKCGFADVEAIVAGVITAQFFRDPSTVAALLRLQFHDCFVNGCDASILVDGSNSEKTAIPNLSVRGYEIIDQAKAAVENACPGVVSC
ADVIAIATRDVVFL
SGGGRYDVQTGRRDGLVSAAKNVSLPGPAISVPEAIAAFSDKGLTVTEMVLLLGAHSVGIAHCSFIKDRLFNFENTGRPDPSMDPSLENILRSRCPPFATVDNTVN
LDQNSFSPFTISNTYYQTVMLHRGILQIDQDLGTDPLTMPVVKNLANAFDFPARFGAAMVKLGAIGVLTGTQGEIRRSCRATNR*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (introns 1 and 2). No EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTGAGGCAGCATTTCTGACATTAGCCCTTGGGTTCATTTCAGTGAACTTTACTGGCTTCTGCTTTGGTGCACTGCAAGTGGGATTTTACAGAGGAAAATGTGGTTTTGCAGAT
GTTGAGGCTATAGTGGCTGGAGTTATTACTGCTCAGTTCTTCAGGGATCCTTCAACTGTGGCTGCCCTCTTACGCTTGCAGTTCCATGACTGCTTTGTCAAT
ATGTAAGCTTACATTTCT
GCATATTTTCGCCCAGGAATTAGGAACTCTTAATTCTGTTTGCATCTAATAATTTTAAGCTTAACCAACCTGCTATAATCCCTCCACGATCCACATAGCTAGAAGCATGGATGATGCATT
GGTTTGGTTGGCAAGCAAGTTTTGTGTGCACTTCTCTTCAGTTTAAGCACATGCTAGTTTCTGCTATTTTATGCATGACTTATATTTTGCACTAATATTAACAATAAACAAAAATAATAG
TAATGTTCTAATATTCTGAGTTAATATTATGGAAGTTTTCAGAATTTTGCCCAAACGTTAGCTTGCTAAGAATTTTGGTATCTGTTCATTGATGCGTAGTGTTTGCATTGTCGATCGAGA
GAGATGTAATTATTGAACTGATTAACTATTTATTGGTGGAAATAATGATGATGAAAAAGGGGTGTGATGCATCAATACTAGTGGATGGAAGTAACAGTGAGAAAACAGCAATACCGAATT
TGAGTGTGAGGGGATATGAAATTATAGACCAAGCAAAGGCTGCTGTGGAAAATGCTTGCCCTGGTGTGGTCTCCTGTGCTGATGTCATTGCAATAGCTACAAGAGATGTTGTTTTCTTG
T
GGTAATTGAATCTCTCTCTTTGTTACAGTTTGTGATTCTTCAGAAAATCCAAATTGAGTTAACTAGTGATTCCTGTCCAGAGTGGTGGAGGGAGATACGATGTTCAAACAGGAAGAAGGG
ATGGTTTAGTCTCTGCAGCTAAAAATGTGAGCCTGCCAGGTCCTGCAATATCAGTGCCCGAGGCCATTGCAGCATTTTCTGATAAAGGTCTCACTGTTACAGAAATGGTGCTCCTACTAG
GTGCTCATTCTGTTGGGATTGCACATTGCTCATTCATCAAAGACCGTCTTTTCAACTTTGAAAACACTGGCAGACCTGATCCATCCATGGATCCTTCCCTAGAAAACATTCTGAGATCAA
GGTGCCCTCCATTTGCCACAGTAGACAACACAGTGAACCTTGATCAAAACTCATTTAGCCCATTTACAATAAGCAATACATACTATCAGACTGTGATGCTGCATAGAGGCATTCTCCAAA
TCGACCAAGATTTAGGAACTGACCCCTTGACAATGCCTGTAGTGAAAAACCTGGCAAATGCGTTTGATTTCCCTGCCAGGTTTGGTGCTGCCATGGTTAAGTTGGGAGCTATAGGGGTTC
TGACTGGCACACAAGGAGAAATTAGGAGATCTTGTAGGGCCACTAATAGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGGCTGAGGCAGCATTTCTGACATTAGCCCTTGGGTTCATTTCAGTGAACTTTACTGGCTTCTGCTTTGGTGCACTGCAAGTGGGATTTTACAGAGGAAAATGTGGTTTTGCAGAT
GTTGAGGCTATAGTGGCTGGAGTTATTACTGCTCAGTTCTTCAGGGATCCTTCAACTGTGGCTGCCCTCTTACGCTTGCAGTTCCATGACTGCTTTGTCAAT
GGGTGTGATGCATCAATA
CTAGTGGATGGAAGTAACAGTGAGAAAACAGCAATACCGAATTTGAGTGTGAGGGGATATGAAATTATAGACCAAGCAAAGGCTGCTGTGGAAAATGCTTGCCCTGGTGTGGTCTCCTGT
GCTGATGTCATTGCAATAGCTACAAGAGATGTTGTTTTCTTG
AGTGGTGGAGGGAGATACGATGTTCAAACAGGAAGAAGGGATGGTTTAGTCTCTGCAGCTAAAAATGTGAGCCTGCCA
GGTCCTGCAATATCAGTGCCCGAGGCCATTGCAGCATTTTCTGATAAAGGTCTCACTGTTACAGAAATGGTGCTCCTACTAGGTGCTCATTCTGTTGGGATTGCACATTGCTCATTCATC
AAAGACCGTCTTTTCAACTTTGAAAACACTGGCAGACCTGATCCATCCATGGATCCTTCCCTAGAAAACATTCTGAGATCAAGGTGCCCTCCATTTGCCACAGTAGACAACACAGTGAAC
CTTGATCAAAACTCATTTAGCCCATTTACAATAAGCAATACATACTATCAGACTGTGATGCTGCATAGAGGCATTCTCCAAATCGACCAAGATTTAGGAACTGACCCCTTGACAATGCCT
GTAGTGAAAAACCTGGCAAATGCGTTTGATTTCCCTGCCAGGTTTGGTGCTGCCATGGTTAAGTTGGGAGCTATAGGGGTTCTGACTGGCACACAAGGAGAAATTAGGAGATCTTGTAGG
GCCACTAATAGGTAG

Retrieve as FASTA