Entry information : PtPrx92 (POPTR_0010s14460 / Potri.010G134500)
Entry ID 3209
Creation 2006-06-14 (Claudia Cosio)
Last sequence changes 2006-06-14 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx92 (POPTR_0010s14460 / Potri.010G134500)
Name (synonym) PtPrx92 (POPTR_0010s14460 / Potri.010G134500)
Class Class III peroxidase    [Orthogroup: Prx025]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx92
start..stop
S start..stop
PtPrx95 624 0 1..341 1..340
MePrx12 557 0 4..341 5..340
MePrx128 556 0 27..341 28..342
CsPrx41 546 0 1..341 1..338
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14880090..14880329 240 N° 2 14879786..14879977 192 N° 3 14879524..14879689 166 N° 4 14878980..14879407 428
complement(join(14878980..14879407,14879524..14879689,14879786..14879977,1488009 0..14880329))


exon

Literature and cross-references PtPrx92 (POPTR_0010s14460 / Potri.010G134500)
Literature DOE joint genome institute.
DNA ref. Phytozome 12:   Chr10 (14880329..14878980)
Omic ref. ePlant:   Potri.010G134500
Protein sequence: PtPrx92 (POPTR_0010s14460 / Potri.010G134500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   341 (311)
PWM (Da):   %s   36915.34 (33702.6)  
PI (pH):   %s   4.6 (4.46) Peptide Signal:   %s   cut: 31 range:31-341
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFPLHESKLPVLPLAMLVFISILSGSLHASDPPLTLDHYASTCPDVFEIVKKEMECEVLSDPRNAALILRLHFHDCFVQGCDGSVLLDDTITLQGEKEALTNTNSLKGFKIIDRIKNKIESECPGIVSCADILTIAARDAVILVGGPYWDVPVGRKDSKTASFELAASNLPTADEGLLSIMTKFLYQGLSATDLVALSGAHTIGMARCANFRSRIYGDFETTSDASPMSETYLNSLKSTCPAAGGSGDNNISAMDYATPNLFDNSFYQLLLKGDGLLSSDQELYSSMLGIETKNLVIKYAHDSLAFFQQFADSMVKMGNITNPDSFVNGEVRTNCRFVNT

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (3 introns). Splicing predicted by the PeroxiBase team with FGeneSH.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCCCCTTCATGAATCAAAGCTTCCCGTATTACCACTTGCTATGCTGGTTTTTATCTCCATCCTCAGCGGAAGCTTGCATGCAAGTGACCCTCCTTTAACTTTGGACCACTAT
GCTTCGACATGCCCCGATGTGTTTGAGATTGTCAAGAAAGAAATGGAATGTGAAGTTCTTTCTGATCCACGTAATGCAGCTTTGATATTGAGATTACATTTCCATGACTGCTTCGTTCAG
GTTCACATCTCTCTTCTTTTGGCATTATCATTGATTTTCTTCAACTCTAATATCCTTAGTCCTAAATGGTACCCAAGCCAACTAATAGGGTATGGTCCCATAATTGGTGCAGGGGTGTGA
TGGTTCAGTTTTGCTAGACGACACAATCACCTTGCAAGGGGAAAAGGAAGCTTTAACAAACACAAACTCTCTGAAAGGATTTAAAATCATTGATAGAATTAAGAACAAGATCGAGTCCGA
GTGCCCTGGAATAGTCTCTTGTGCAGATATCCTCACCATCGCCGCAAGAGATGCAGTCATTCTG
GTACTAATACAATTCAGCATTATATATTAGCTAGCAGGAGTGGTGGAAGAATGAGT
TTATATTTTTCTCCTTTTCGATTGGTTGCAATGTTGACAGGTTGGTGGACCATACTGGGATGTTCCTGTGGGAAGGAAAGATTCTAAAACTGCAAGTTTCGAGCTCGCAGCATCAAATCT
TCCAACAGCAGATGAGGGTCTGCTATCTATCATGACCAAGTTCCTTTACCAGGGCCTTTCAGCTACTGATTTGGTAGCTCTTTCAG
GTAGGATGCTCGGTTCTGTTATATTTGGTAACCC
TGCTTAGAACTACTACTTGAAAACTCATAAAACCATTCCAATTCTAATATTTAGAACCCATTATTGTGTGTGAAATCTGCAGGGGCGCACACTATTGGCATGGCACGTTGTGCGAATTTT
CGATCAAGGATTTACGGGGACTTTGAAACAACTTCGGATGCAAGTCCAATGTCTGAGACCTATCTCAACAGCTTGAAATCGACGTGCCCAGCTGCTGGAGGATCTGGGGACAATAACATA
TCAGCGATGGACTATGCCACGCCTAATCTTTTTGACAACTCTTTCTATCAATTACTATTGAAAGGAGATGGACTGCTAAGCTCAGACCAGGAACTGTACTCAAGCATGCTTGGGATCGAA
ACAAAGAATCTTGTGATAAAGTATGCTCATGACTCCCTTGCTTTCTTTCAGCAATTCGCAGATTCTATGGTGAAAATGGGAAATATTACAAATCCTGATAGCTTCGTCAACGGGGAAGTT
AGGACAAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTTCCCCTTCATGAATCAAAGCTTCCCGTATTACCACTTGCTATGCTGGTTTTTATCTCCATCCTCAGCGGAAGCTTGCATGCAAGTGACCCTCCTTTAACTTTGGACCACTAT
GCTTCGACATGCCCCGATGTGTTTGAGATTGTCAAGAAAGAAATGGAATGTGAAGTTCTTTCTGATCCACGTAATGCAGCTTTGATATTGAGATTACATTTCCATGACTGCTTCGTTCAG
GGGTGTGATGGTTCAGTTTTGCTAGACGACACAATCACCTTGCAAGGGGAAAAGGAAGCTTTAACAAACACAAACTCTCTGAAAGGATTTAAAATCATTGATAGAATTAAGAACAAGATC
GAGTCCGAGTGCCCTGGAATAGTCTCTTGTGCAGATATCCTCACCATCGCCGCAAGAGATGCAGTCATTCTG
GTTGGTGGACCATACTGGGATGTTCCTGTGGGAAGGAAAGATTCTAAA
ACTGCAAGTTTCGAGCTCGCAGCATCAAATCTTCCAACAGCAGATGAGGGTCTGCTATCTATCATGACCAAGTTCCTTTACCAGGGCCTTTCAGCTACTGATTTGGTAGCTCTTTCAG
GG
GCGCACACTATTGGCATGGCACGTTGTGCGAATTTTCGATCAAGGATTTACGGGGACTTTGAAACAACTTCGGATGCAAGTCCAATGTCTGAGACCTATCTCAACAGCTTGAAATCGACG
TGCCCAGCTGCTGGAGGATCTGGGGACAATAACATATCAGCGATGGACTATGCCACGCCTAATCTTTTTGACAACTCTTTCTATCAATTACTATTGAAAGGAGATGGACTGCTAAGCTCA
GACCAGGAACTGTACTCAAGCATGCTTGGGATCGAAACAAAGAATCTTGTGATAAAGTATGCTCATGACTCCCTTGCTTTCTTTCAGCAATTCGCAGATTCTATGGTGAAAATGGGAAAT
ATTACAAATCCTGATAGCTTCGTCAACGGGGAAGTTAGGACAAACTGCAGATTTGTGAACACATGA

Retrieve as FASTA