Entry information : PtPrx94 (POPTR_0007s10040)
Entry ID 3215
Creation 2006-07-21 (Claudia Cosio)
Last sequence changes 2006-07-21 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx94 (POPTR_0007s10040)
Name (synonym) PtPrx94 (POPTR_0007s10040)
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx94
start..stop
S start..stop
RcPrx21 535 0 1..330 3..333
VvPrx04 531 0 11..330 1..320
EgrPrx134 526 0 4..330 2..328
EglPrx134 526 0 4..330 2..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9726780..9727001 222 N° 2 9726503..9726703 201 N° 3 9726253..9726418 166 N° 4 9725434..9725840 407
complement(join(9725434..9725840,9726253..9726418,9726503..9726703,9726780..9727 001))


exon

Literature and cross-references PtPrx94 (POPTR_0007s10040)
DNA ref. Phytozome 12:   scaffold_7 (9727001..9725434)
Cluster/Prediction ref. JGI gene:   693605
Omic ref. ePlant:   Potri.007G053400
Protein sequence: PtPrx94 (POPTR_0007s10040)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   331 (304)
PWM (Da):   %s   35698.16 (32689.6)  
PI (pH):   %s   9.28 (9.43) Peptide Signal:   %s   cut: 28 range:28-331
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAARFHLLLVLSLTLSLCHFPDTTWAQLRQNYYASSCPRVESIVRGVVQNKIKQTFVTIPATLRLFFHDCFVQGCDASVIVASTATNKAEKDHSDNLSLAGDGFDTVIKAKAAVDATPGCKNKVSCADILAIATRDVIALSGGPSYPVELGRLDGLSSTAASVNGKLPQPTFSLNQLTAMFAANGLSQTDMIALSAAHTLGFSHCSKFANRIYSFSRQGPIDPTLNRTYAKTLQTLCPKNVDSRIAINMDPNTPNTFDNMYYKNLVQGMGLFTSDQVLFTDSRSKPTVTKWATDSQAFQQAFITAMTKLGRVGVKSGRNGKIRQDCAVLA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). ESTs from various hybrids.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTGCCCGGTTCCATCTCTTACTTGTTCTTTCACTCACTCTCAGTTTGTGCCACTTCCCTGACACCACATGGGCGCAGCTTAGGCAAAATTACTACGCTAGCAGTTGCCCCAGA
GTGGAAAGCATAGTTAGGGGTGTCGTTCAGAATAAAATTAAACAAACCTTTGTTACGATTCCGGCAACTCTCAGGCTTTTCTTCCATGATTGCTTTGTTCAG
GTTTATGGAATACAAATA
AACAGCCCATTGCTTCATTCATTTTCTCTAGCTTAAGATTAATGTTTTGTTTCTATAGGGCTGTGATGCTTCAGTTATAGTGGCCTCCACTGCAACCAACAAGGCGGAGAAGGACCATTC
TGATAATTTATCATTAGCTGGAGATGGATTTGACACTGTGATCAAAGCGAAAGCGGCTGTTGATGCCACCCCCGGATGCAAAAACAAGGTCTCGTGTGCTGATATCCTTGCCATAGCAAC
AAGAGATGTTATCGCACTG
GTCAGACCATCATGTTCTTGATCTCCTTTCTTCTTCTTTTTTTTCCTGATATGTTCAAGCGCTATAAATGTGATATTGATGCAGTCTGGTGGGCCTTCATA
TCCTGTTGAATTGGGACGATTGGATGGTTTAAGCTCAACAGCTGCTAGTGTCAATGGGAAGCTGCCTCAGCCAACTTTCTCTTTGAATCAGCTTACTGCTATGTTTGCTGCCAACGGACT
CAGCCAAACTGACATGATTGCTCTCTCAG
GTATGACAATCATCATCGTAATTGTCCTAAATTCACGTGCTCCAATCACAGACATTTTATCTTGGTGGGTCCTGAAATTGGATCTCTCTTG
GCAACATTTATTTATTTATTTTTGTCAATGGAGCTCCTATCATTAATCAAACCCACAAGCAACCATTTAATTTATACTCCTATTTGTTTTTCATCAATGAAATGATGCATATTATAGGTC
TTTTTTTTTTAATTTAAAGATAGGAGTATCTTTAGATGAATTTATAATTTCATTGAGCTTGATTTTTCTTTGCATAATTTTGATAATGTACCTCCAATAATATATTAAAAAATTTAATTA
TATGCAACTTAAAAAATGTGCACTATATTGTTTCAAGATGGATCAATTGATGATTTTTTTACTCTTTTTTTTTCCCATCAGCGGCACACACGCTTGGATTCTCTCATTGTAGCAAATTTG
CCAACAGGATATATAGTTTTAGCAGGCAAGGTCCGATCGACCCTACACTCAACCGAACATATGCAAAAACACTGCAAACTCTGTGCCCCAAAAACGTTGACTCCAGAATAGCCATCAACA
TGGACCCAAACACTCCCAACACCTTTGACAACATGTATTACAAGAACCTCGTGCAAGGAATGGGCCTCTTCACCTCTGATCAAGTTCTATTCACAGACTCAAGGTCCAAGCCAACTGTTA
CTAAATGGGCTACTGACTCACAGGCCTTTCAACAAGCCTTTATCACTGCCATGACAAAGTTGGGCCGCGTCGGTGTCAAGAGCGGTCGAAATGGGAAAATTCGTCAAGACTGCGCAGTTT
TGGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTGCCCGGTTCCATCTCTTACTTGTTCTTTCACTCACTCTCAGTTTGTGCCACTTCCCTGACACCACATGGGCGCAGCTTAGGCAAAATTACTACGCTAGCAGTTGCCCCAGA
GTGGAAAGCATAGTTAGGGGTGTCGTTCAGAATAAAATTAAACAAACCTTTGTTACGATTCCGGCAACTCTCAGGCTTTTCTTCCATGATTGCTTTGTTCAG
GGCTGTGATGCTTCAGTT
ATAGTGGCCTCCACTGCAACCAACAAGGCGGAGAAGGACCATTCTGATAATTTATCATTAGCTGGAGATGGATTTGACACTGTGATCAAAGCGAAAGCGGCTGTTGATGCCACCCCCGGA
TGCAAAAACAAGGTCTCGTGTGCTGATATCCTTGCCATAGCAACAAGAGATGTTATCGCACTG
TCTGGTGGGCCTTCATATCCTGTTGAATTGGGACGATTGGATGGTTTAAGCTCAACA
GCTGCTAGTGTCAATGGGAAGCTGCCTCAGCCAACTTTCTCTTTGAATCAGCTTACTGCTATGTTTGCTGCCAACGGACTCAGCCAAACTGACATGATTGCTCTCTCAG
CGGCACACACG
CTTGGATTCTCTCATTGTAGCAAATTTGCCAACAGGATATATAGTTTTAGCAGGCAAGGTCCGATCGACCCTACACTCAACCGAACATATGCAAAAACACTGCAAACTCTGTGCCCCAAA
AACGTTGACTCCAGAATAGCCATCAACATGGACCCAAACACTCCCAACACCTTTGACAACATGTATTACAAGAACCTCGTGCAAGGAATGGGCCTCTTCACCTCTGATCAAGTTCTATTC
ACAGACTCAAGGTCCAAGCCAACTGTTACTAAATGGGCTACTGACTCACAGGCCTTTCAACAAGCCTTTATCACTGCCATGACAAAGTTGGGCCGCGTCGGTGTCAAGAGCGGTCGAAAT
GGGAAAATTCGTCAAGACTGCGCAGTTTTGGCTTAA

Retrieve as FASTA