Entry information : PtPrx97 (POPTR_0003s21660 / Potri.003G214500)
Entry ID 3218
Creation 2006-07-21 (Claudia Cosio)
Last sequence changes 2006-07-21 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx97 (POPTR_0003s21660 / Potri.003G214500)
Name (synonym) PtPrx97 (POPTR_0003s21660 / Potri.003G214500)
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx97
start..stop
S start..stop
MePrx135 482 1e-173 2..309 19..328
GrPrx41 479 3e-172 1..309 21..332
NnPrx55 479 4e-172 2..308 23..333
PpePrx79 475 1e-170 2..309 22..332
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 19730210..19730374 165 N° 2 19730632..19730814 183 N° 3 19731166..19731331 166 N° 4 19731499..19731914 416
join(19730210..19730374,19730632..19730814,19731166..19731331,19731499..19731914 )


exon

Literature and cross-references PtPrx97 (POPTR_0003s21660 / Potri.003G214500)
DNA ref. Phytozome 12:   scaffold_3 (19730210..19731914)
Omic ref. ePlant:   Potri.003G214500
Protein sequence: PtPrx97 (POPTR_0003s21660 / Potri.003G214500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309
PWM (Da):   %s   33300.75  
PI (pH):   %s   6.12
Sequence 350
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLCVVARSQLTTDFYSTTCPNLLQIVRREVQKAIKFETRMAASLIRLHFHDCFVNGCDASVLLDGNDGEKFALPNINSARGFEVVDAIKTAVESQCSGVVSCADILTIAARDSVLLSGGKSWRVLLGRRDGLVANQTGANAKLPSPFEDVDTIINKFAAVGLNIIDVVALSGAHTIGQARCATFNNRLFNFSGTGAPDSTMESSMVSDLQNLCPLTDDGNKTTVLDRNSTDLFDIHYFQNLLNNKGLLSSDQELFSSTNLTTKALVQTYSTNQNLFLNDFANSMIKMGNISPLTGSSGEIRKKCSVVNS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Contig contains 4 other peroxidase sequences
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTATGTGTAGTTGCCAGGTCCCAACTGACTACCGATTTCTATTCGACAACATGTCCTAACCTTCTCCAAATTGTCCGTAGAGAAGTTCAGAAAGCTATCAAGTTCGAAACACGTATGG
CAGCCTCTTTGATTCGGCTTCATTTTCATGACTGCTTTGTCAAT
GTGAGTTTAAGCAGACCCATGCTCATAAGCCTGTGCTAAACATCTAACAAATTTGTTGCTGGAGGATTGAGTGGTT
GCAATATGATTTCCTATAGTCTTTTATGACTTCAGATTGATGAGTTTAAGAATTATTCCACTTGTACCTTGTGCTTTTTAGCCACACTAACTTTTCATTTCTTAGATATATTTTGCAATC
AACTTTTCTAAAGCATCATTAGGTCATAATTGACATAAAAACAATGTCTTCTTCTTGATAGGGTTGTGATGCATCAGTTCTGCTGGATGGAAATGATGGTGAGAAGTTTGCTTTGCCTAA
CATAAACTCGGCAAGGGGATTTGAAGTTGTGGATGCAATAAAAACTGCTGTGGAAAGTCAATGTAGTGGCGTTGTATCTTGTGCTGATATACTAACCATAGCTGCCCGAGATTCGGTCCT
CCTT
GTAAGTTTACTCTTTAGATCCTAGCTCGTTTCCGAACACATCAGGTATCCTGAGATAAAACATTTTGCAAGTTAATGATCTGAATAAACTTTGCAGAGAGGACTAATAATAACTTC
TTACAGCAGATGATGAGCTTAATATATATCAAAGCAAATGTTTATTGAAGAATTTCCTCATGACAAATATATGACTGACTCTGATAAAAGAGTTCCTTCCTGAAACTACATATCTAATTC
ACTTTCTTTCTTGAGTTGCATTATCACAACCATTCAAGTGTTAGTCCAATATAATATGTTTATCAAGTGAATATGAAGTATTTATAGATGACTTTGAATGAAAATATTGCTGCAGAGTGG
GGGGAAATCATGGAGAGTTCTGCTCGGAAGAAGAGATGGACTAGTGGCTAACCAGACTGGAGCAAATGCTAAACTTCCTTCCCCGTTTGAAGATGTGGATACGATCATCAACAAGTTTGC
TGCAGTAGGATTAAATATCATAGACGTAGTCGCCTTATCCG
GTAATGCATCACATATTCATGGACGGCATGATGCTCTGTGGTCAACTTTGATAAGAAATGCCCCCGTATTGCGTGTCAT
TCAGTGCTTGTGTATTCTCATCAGAAATTGTGAATTTCATAAATAATTGCATTATGCTGAAGATTGGATATCATGTAATTTCATGTAGGTGCTCACACAATTGGACAAGCAAGATGTGCC
ACCTTCAACAACAGATTGTTCAACTTCTCGGGAACCGGTGCTCCGGACAGTACAATGGAATCAAGTATGGTGTCTGATCTGCAAAATCTATGTCCACTAACTGATGATGGCAACAAGACT
ACAGTTCTTGATCGGAACTCCACTGATCTATTTGACATCCACTATTTCCAGAACTTGCTAAACAATAAGGGTCTTCTCTCTTCTGACCAAGAACTATTTTCAAGTACCAATTTGACAACC
AAAGCTCTGGTTCAGACCTATAGCACTAATCAAAATCTTTTCTTAAATGACTTTGCTAATTCCATGATCAAAATGGGGAATATAAGCCCGCTAACAGGGTCTAGTGGAGAGATCAGGAAA
AAATGTAGTGTGGTTAATTCGTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGTTATGTGTAGTTGCCAGGTCCCAACTGACTACCGATTTCTATTCGACAACATGTCCTAACCTTCTCCAAATTGTCCGTAGAGAAGTTCAGAAAGCTATCAAGTTCGAAACACGTATGG
CAGCCTCTTTGATTCGGCTTCATTTTCATGACTGCTTTGTCAAT
GGTTGTGATGCATCAGTTCTGCTGGATGGAAATGATGGTGAGAAGTTTGCTTTGCCTAACATAAACTCGGCAAGGG
GATTTGAAGTTGTGGATGCAATAAAAACTGCTGTGGAAAGTCAATGTAGTGGCGTTGTATCTTGTGCTGATATACTAACCATAGCTGCCCGAGATTCGGTCCTCCTT
AGTGGGGGGAAAT
CATGGAGAGTTCTGCTCGGAAGAAGAGATGGACTAGTGGCTAACCAGACTGGAGCAAATGCTAAACTTCCTTCCCCGTTTGAAGATGTGGATACGATCATCAACAAGTTTGCTGCAGTAG
GATTAAATATCATAGACGTAGTCGCCTTATCCG
GTGCTCACACAATTGGACAAGCAAGATGTGCCACCTTCAACAACAGATTGTTCAACTTCTCGGGAACCGGTGCTCCGGACAGTACAA
TGGAATCAAGTATGGTGTCTGATCTGCAAAATCTATGTCCACTAACTGATGATGGCAACAAGACTACAGTTCTTGATCGGAACTCCACTGATCTATTTGACATCCACTATTTCCAGAACT
TGCTAAACAATAAGGGTCTTCTCTCTTCTGACCAAGAACTATTTTCAAGTACCAATTTGACAACCAAAGCTCTGGTTCAGACCTATAGCACTAATCAAAATCTTTTCTTAAATGACTTTG
CTAATTCCATGATCAAAATGGGGAATATAAGCCCGCTAACAGGGTCTAGTGGAGAGATCAGGAAAAAATGTAGTGTGGTTAATTCGTGA

Retrieve as FASTA