Entry information : PtPrx100 (POPTR_0001s04870 / PT01G01130 / Potri.001G011500)
Entry ID 3246
Creation 2006-06-06 (Claudia Cosio)
Last sequence changes 2006-06-06 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx100 (POPTR_0001s04870 / PT01G01130 / Potri.001G011500)
Name (synonym) PtPrx100 (POPTR_0001s04870 / PT01G01130 / Potri.001G011500)
Class Class III peroxidase    [Orthogroup: Prx006]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx100
start..stop
S start..stop
PkPrx01 632 0 1..318 1..318
PalPrx06 612 0 9..318 1..310
PpePrx78 456 6e-163 3..318 6..324
PpePrx73 455 1e-162 3..318 6..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3736928..3737131 204 N° 2 3736633..3736821 189 N° 3 3736255..3736417 163 N° 4 3735731..3736131 401
complement(join(3735731..3736131,3736255..3736417,3736633..3736821,3736928..3737 131))


exon

Literature and cross-references PtPrx100 (POPTR_0001s04870 / PT01G01130 / Potri.001G011500)
DNA ref. Phytozome 12:   scaffold_1 (3737131..3735731)
Omic ref. ePlant:   Potri.001G011500
Protein sequence: PtPrx100 (POPTR_0001s04870 / PT01G01130 / Potri.001G011500)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (297)
PWM (Da):   %s   34227.8 (32004.7)  
PI (pH):   %s   4.31 (4.35) Peptide Signal:   %s   cut: 22 range:22-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSVLATVICVVMLFWGISDAQLSPTFYASTCPNVSSIVRGVVEQAARNDVRLGAKLIRMHFHDCFVDGCDGSILLVDANGINSEQDELPNQSVEGYGVVDDIKTAVENVCPGIVSCADILALASEILVTLAGGPTWQVPLGRRDSTTANAARTSDIPSPFETFENLSLKFSNKELDSTDLVALSGAHTFGRSQCQFFSQRLNDTNPDPTLDTTYLQTLRQACPQGGNPSRLNNLDPTTPDDFDNNYFTNLQNNRGLLQTDQILFSTSGADTVAVVNRFANSQTAFFDSFAQSMIKLGNLSPLTGSNGEIRADCKRVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGTTCTAGCTACAGTGATATGTGTAGTAATGTTGTTTTGGGGCATTTCTGATGCTCAATTAAGCCCCACGTTTTATGCTAGCACTTGCCCGAATGTGTCGAGCATTGTGCGA
GGTGTAGTGGAGCAAGCTGCGCGAAATGATGTCCGGCTTGGAGCCAAGCTCATTCGCATGCACTTCCATGATTGCTTTGTCGAT
GTAATTATCTTCCATATATAGTTTCTTAATGATTCA
CCTAGCAGAAAGATTTTCTTTATGTATGAAGTACTAATGCACTACTCTTCTTTTCGTATTTTTTTGGCAGGGCTGCGATGGCTCTATTCTGCTGGTCGATGCGAATGGCATAAATAGTGA
GCAAGATGAACTCCCTAATCAATCCGTAGAAGGTTATGGTGTCGTTGATGACATTAAAACAGCAGTGGAGAATGTTTGTCCTGGCATCGTCTCCTGCGCAGATATATTAGCCCTTGCATC
TGAAATATTGGTTACCTTG
GTATAGTATTATCAACCTTTCATAATGACCTTTCTTAATGTATTGCCAGCATCTCATGATGTCATAGGCTAGTTGGTCAAGTAATGAGCTCATAAGTAGAA
AAAACAAAAAAAGGGTTGAAAAACTGAAGATGACTTGTGCTAGCAAGTCTTAGATGAGTTTACTTGAGTTGATTACGAATTTTGTGGCCTTAACAAGTAAATGATATGTTGCAGGCAGGA
GGTCCAACATGGCAAGTGCCACTGGGAAGAAGGGATAGTACGACTGCAAACGCAGCAAGAACTTCTGACATTCCTAGCCCTTTCGAAACCTTTGAAAATCTTTCTCTCAAGTTCTCAAAC
AAGGAACTTGATTCCACTGATCTAGTTGCTTTATCTG
GTAATTAATTAGAAATCTTTCCAAATCTTCCACACCAAAATACAGCACGAACAGCTCTTATTACTTGTGTTTAGCATACAGTA
CTATTGTTTTATGCTTACAAAAGATAAAATGTTATTTCAGGTGCACATACATTTGGGAGGTCTCAGTGCCAATTCTTCAGCCAGAGACTCAATGATACAAACCCTGATCCAACCTTAGAC
ACAACATACTTGCAGACACTTCGCCAAGCATGCCCACAAGGCGGAAATCCAAGTAGATTGAACAATCTTGATCCTACAACTCCTGATGATTTTGACAACAACTACTTCACAAATCTTCAG
AACAATCGTGGCCTTCTCCAAACTGACCAAATACTCTTTTCTACTAGCGGGGCTGATACTGTTGCCGTAGTCAACCGGTTTGCTAACAGCCAGACCGCCTTCTTTGATAGCTTTGCTCAG
TCTATGATAAAGTTGGGAAATTTAAGTCCTTTGACAGGAAGCAATGGAGAAATCAGAGCCGACTGTAAGAGGGTCAATTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTCTGTTCTAGCTACAGTGATATGTGTAGTAATGTTGTTTTGGGGCATTTCTGATGCTCAATTAAGCCCCACGTTTTATGCTAGCACTTGCCCGAATGTGTCGAGCATTGTGCGA
GGTGTAGTGGAGCAAGCTGCGCGAAATGATGTCCGGCTTGGAGCCAAGCTCATTCGCATGCACTTCCATGATTGCTTTGTCGAT
GGCTGCGATGGCTCTATTCTGCTGGTCGATGCGAAT
GGCATAAATAGTGAGCAAGATGAACTCCCTAATCAATCCGTAGAAGGTTATGGTGTCGTTGATGACATTAAAACAGCAGTGGAGAATGTTTGTCCTGGCATCGTCTCCTGCGCAGATATA
TTAGCCCTTGCATCTGAAATATTGGTTACCTTG
GCAGGAGGTCCAACATGGCAAGTGCCACTGGGAAGAAGGGATAGTACGACTGCAAACGCAGCAAGAACTTCTGACATTCCTAGCCCT
TTCGAAACCTTTGAAAATCTTTCTCTCAAGTTCTCAAACAAGGAACTTGATTCCACTGATCTAGTTGCTTTATCTG
GTGCACATACATTTGGGAGGTCTCAGTGCCAATTCTTCAGCCAG
AGACTCAATGATACAAACCCTGATCCAACCTTAGACACAACATACTTGCAGACACTTCGCCAAGCATGCCCACAAGGCGGAAATCCAAGTAGATTGAACAATCTTGATCCTACAACTCCT
GATGATTTTGACAACAACTACTTCACAAATCTTCAGAACAATCGTGGCCTTCTCCAAACTGACCAAATACTCTTTTCTACTAGCGGGGCTGATACTGTTGCCGTAGTCAACCGGTTTGCT
AACAGCCAGACCGCCTTCTTTGATAGCTTTGCTCAGTCTATGATAAAGTTGGGAAATTTAAGTCCTTTGACAGGAAGCAATGGAGAAATCAGAGCCGACTGTAAGAGGGTCAATTAG

Retrieve as FASTA