Entry information : PtPrx102 (POPTR_0003s21610 / Potri.003G214900)
Entry ID 3249
Creation 2006-06-06 (Claudia Cosio)
Last sequence changes 2006-06-06 (Claudia Cosio)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-03-07 (Qiang Li)
Peroxidase information: PtPrx102 (POPTR_0003s21610 / Potri.003G214900)
Name (synonym) PtPrx102 (POPTR_0003s21610 / Potri.003G214900)
Class Class III peroxidase    [Orthogroup: Prx005]
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx102
start..stop
S start..stop
PkPrx04 666 0 1..343 1..343
PalPrx04 660 0 7..343 1..337
PtremPrx09 654 0 7..343 1..337
PtPrx99 533 0 1..343 1..343
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21224785..21224997 213 N° 2 21225089..21225280 192 N° 3 21225463..21225631 169 N° 4 21225998..21226455 458
join(21224785..21224997,21225089..21225280,21225463..21225631,21225998..21226455 )


exon

Literature and cross-references PtPrx102 (POPTR_0003s21610 / Potri.003G214900)
DNA ref. Phytozome 12:   Chr03 (21224785..21226455)
Omic ref. ePlant:   Potri.003G214900
Protein sequence: PtPrx102 (POPTR_0003s21610 / Potri.003G214900)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   343 (319)
PWM (Da):   %s   37021.58 (34452.2) Transmb domain:   %s   i7-24o
PI (pH):   %s   4.37 (4.27) Peptide Signal:   %s   cut: 25 range:25-343
Sequence 384
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLSKLMVVALFYAFLVGGPLAYGQLTPTFYDDTCPSVVSIIRGVIAETLIFDRRIGASLIRLHFHDCFVNGCDGSILLDKTATIDTEKEAFANNNSARGFDVVDIMKERLEGVCPDTVSCADILAIAAEESVVLAGGPWWPVPLGRRDSLTANRTAANAFIPGPRDTLERLRSRFTVVGLNNNTDLVALSGAHTFGRAQCRTFIDRLYNFNNTGLPDPTLDTTSLATLQQLCPQGGNGTVLADLDPTTPDGFDNNYFSNLQANKGLLQSDQELFSTPGADDIIELVNIFSNDETAFFESFVESMIRMGNLSPLTGTEGEIRLNCRVVNANLAGKDSVLVSSV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns). Contig contains 4 other peroxidase sequences.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTTTCAAAACTTATGGTTGTAGCTTTATTCTATGCATTTTTGGTTGGAGGGCCATTAGCCTATGGTCAGCTTACTCCAACATTTTATGATGACACATGTCCATCTGTGGTCAGCA
TTATCCGTGGAGTGATTGCAGAGACCTTGATTTTCGATCGCCGGATCGGTGCTAGCCTCATTAGGCTTCACTTCCATGACTGTTTTGTTAAT
GTAAGTTGAAATATGTATTTTGCTGACC
ATGATCAAAGGACTTCTAGAAAAACATTTGAATAGTCCTGACAAGTTGTTGATTTTTTTGCAGGGTTGTGATGGATCTATTTTGTTGGACAAAACTGCTACTATAGACACCGAAAAGGAA
GCTTTTGCTAACAATAATTCTGCAAGAGGCTTTGATGTTGTTGATATAATGAAGGAAAGGTTGGAGGGTGTTTGTCCCGATACTGTGTCCTGTGCTGATATACTAGCCATCGCAGCTGAA
GAATCGGTTGTCTTG
GTATGCTATATCACAATTGATTTCATAAGAATTCGAAATCAATTGCTCTTTAATTTTAATTTTTTTACATGTTGGAACTTAAGTGGAAAGCAAATTAAGGCAAAG
GGAACTGAAATCTCAATTTACATAGATCATTTGTATTTTTATAGCATTTATTTTAACCTTCTTTATGGTTACTGCAGGCAGGAGGTCCATGGTGGCCAGTTCCATTAGGAAGAAGAGACA
GTCTAACAGCAAACAGAACTGCTGCTAATGCTTTCATCCCAGGTCCCCGTGACACCCTCGAGCGTCTCAGATCCAGATTTACTGTTGTTGGCCTCAACAACAATACCGATCTGGTAGCAC
TATCTG
GTAACAATTGTTCTTTCCCTTCTTCTTGAGAAACATGATCACAAAATATTAAACTAAAATGCATTGTACTGAATGCGCGTCTCGTCAAACTAACTTCACGCTTCCATAATTTAT
ATGTTATTCTTCGTAAAAGAAATCAATCAAACTCAAAAATTTAAACTGTGATATAATATTCTAAAAATATATTATTTTCTAATTCATTCAAGTAAAAGATTCTTTGATTATTCAAATTCT
GATACCAAATCAAAAACTAATTCAATCTTAAGCTATAAAAATAGTTATATATTACTCTCTACAACTCATCATAAGAAAATTATTTATACCATTATTATTCCTTTGATGACATTTTGGTGC
TTTTATTCTTAGGTGCTCACACATTTGGACGAGCTCAATGTAGAACTTTCATTGATCGATTGTACAACTTCAACAACACAGGCCTTCCTGACCCAACATTGGACACAACTTCCCTAGCAA
CACTTCAGCAATTATGTCCCCAAGGAGGAAACGGGACTGTGCTAGCTGATCTTGATCCCACAACACCTGATGGCTTTGATAATAACTATTTCTCCAATCTTCAAGCTAATAAAGGCCTAC
TTCAGAGTGATCAAGAACTGTTTTCGACTCCTGGGGCTGATGATATCATTGAACTTGTTAACATATTCAGTAATGATGAAACAGCTTTCTTCGAAAGCTTTGTTGAGTCCATGATAAGAA
TGGGGAATCTTAGTCCTTTGACAGGGACAGAAGGTGAGATCAGATTGAACTGCAGAGTAGTCAATGCAAACTTGGCTGGAAAAGATAGTGTGCTTGTTAGCTCAGTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAAGCTTTCAAAACTTATGGTTGTAGCTTTATTCTATGCATTTTTGGTTGGAGGGCCATTAGCCTATGGTCAGCTTACTCCAACATTTTATGATGACACATGTCCATCTGTGGTCAGCA
TTATCCGTGGAGTGATTGCAGAGACCTTGATTTTCGATCGCCGGATCGGTGCTAGCCTCATTAGGCTTCACTTCCATGACTGTTTTGTTAAT
GGTTGTGATGGATCTATTTTGTTGGACA
AAACTGCTACTATAGACACCGAAAAGGAAGCTTTTGCTAACAATAATTCTGCAAGAGGCTTTGATGTTGTTGATATAATGAAGGAAAGGTTGGAGGGTGTTTGTCCCGATACTGTGTCCT
GTGCTGATATACTAGCCATCGCAGCTGAAGAATCGGTTGTCTTG
GCAGGAGGTCCATGGTGGCCAGTTCCATTAGGAAGAAGAGACAGTCTAACAGCAAACAGAACTGCTGCTAATGCTT
TCATCCCAGGTCCCCGTGACACCCTCGAGCGTCTCAGATCCAGATTTACTGTTGTTGGCCTCAACAACAATACCGATCTGGTAGCACTATCTG
GTGCTCACACATTTGGACGAGCTCAAT
GTAGAACTTTCATTGATCGATTGTACAACTTCAACAACACAGGCCTTCCTGACCCAACATTGGACACAACTTCCCTAGCAACACTTCAGCAATTATGTCCCCAAGGAGGAAACGGGACTG
TGCTAGCTGATCTTGATCCCACAACACCTGATGGCTTTGATAATAACTATTTCTCCAATCTTCAAGCTAATAAAGGCCTACTTCAGAGTGATCAAGAACTGTTTTCGACTCCTGGGGCTG
ATGATATCATTGAACTTGTTAACATATTCAGTAATGATGAAACAGCTTTCTTCGAAAGCTTTGTTGAGTCCATGATAAGAATGGGGAATCTTAGTCCTTTGACAGGGACAGAAGGTGAGA
TCAGATTGAACTGCAGAGTAGTCAATGCAAACTTGGCTGGAAAAGATAGTGTGCTTGTTAGCTCAGTTTGA

Retrieve as FASTA