Entry information : PtPrx[P]103 (POPTR_0003s21650 / Potri.003G214600)
Entry ID 3250
Creation 2006-07-25 (Claudia Cosio)
Last sequence changes 2010-06-17 (Marie Brette (Scipio))
Sequence status theoretical translation / pseudogene
Reviewer Qiang Li
Last annotation changes 2012-03-08 (Qiang Li)
Peroxidase information: PtPrx[P]103 (POPTR_0003s21650 / Potri.003G214600)
Name (synonym) PtPrx[P]103 (POPTR_0003s21650 / Potri.003G214600)
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Salicaceae Populus
Organism Populus trichocarpa (Western balsam poplar)    [TaxId: 3694 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PtPrx[P]103
start..stop
S start..stop
EgrPrx55 212 1e-68 29..217 141..331
GmPrx71 211 2e-68 29..217 139..329
GhPrx40 211 5e-68 29..217 142..333
GrPrx40 210 9e-68 29..217 142..333
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21205351..21205431 81 N° 2 21204688..21204848 161 N° 3 21204181..21204598 418  
complement(join(21204181..21204598,21204688..21204848,21205351..21205431))


exon

Literature and cross-references PtPrx[P]103 (POPTR_0003s21650 / Potri.003G214600)
DNA ref. Phytozome 12:   Chr03 (21205431..21204181)
Cluster/Prediction ref. JGI gene:   555260
Omic ref. ePlant:   Potri.003G214600
Protein sequence: PtPrx[P]103 (POPTR_0003s21650 / Potri.003G214600)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   219
PWM (Da):   %s   23958.13  
PI (pH):   %s   9.86
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHVVVRTGPFKGNISGCNPKTVCDDENFGGPSWGSFLGRKDGLTASQTGANKALPSAFDPLIAIASKFAAVGLDSRDLVALCPFIWPRSLFLTPRLYDFNKTRKPDPTLSRTQLKILQKSCPRGGNRTALTNLDPTTVNTFDNRYFSNLQASAGLLQSDQELFSTPKSNTVEMVNQFSANQTAFFESFVASMIKMISYISVLTGMEGEVRTRCRRVNNI

Retrieve as FASTA  
Remarks Partial sequence from genomic (2 last exons). no EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGTTGTGGTACGTACTGGTCCTTTCAAGGGAAACATTTCTGGTTGCAATCCAAAAACTGTATGTGACGACGAAAATGTATATATATACTCTTAAGTAATCATCCATTGAAATTGA
TTGCTACCTATACTGAATTCAACGCGTTACCATTTTATACGATAGTCATTTTAGGGCAGAAAGAACTTCATTAATTGTCTATATAAGGGGTGTGTGTGTGTGTGTGTGTGTATAAACCCA
TCATATTTGTATTACTGAATTGGAAAGATTCTGAGCTTGGTGGTTGTGTATAATTATTTTGTTCTTAATTATATATCTCATGGGTGACAGATTAGGAGTTTTTTCCCCTTCACTATTAAT
TCAAGGTGTACATATCGGAAAGAAATAATTACATGTTGTAACATATATATGCATATGGGTAACCAATCACAAGAATAATTCCTGAACTACGTACGGTTGCAGCCCAACAATCAGTTGCCC
TGGTATGTAACTACCGCTTAGTTTGAATATCTATTATTTTCTGCCAATTTTTTTCAAAACAAAGATCTAAATTTATCATTCTTCTTTGTTTATTAATTGCAAGTTTGGAGGCCCTTCTTG
GGGGAGCTTTCTAGGAAGAAAGGATGGCCTCACAGCTAGCCAAACTGGTGCAAATAAGGCCCTTCCAAGTGCATTTGATCCCCTCATTGCGATTGCATCCAAATTTGCTGCTGTTGGACT
AGACAGTAGAGACCTCGTGGCGTT
GTCTGGTAATTAAATCTTGATATATAAGCATATATTTTCAAGTAACGTGAACGAATTTAATTACTGATGTCTAATAACTTTTTTGCTAGGTGCCCA
TTCATTTGGCCTCGGAGTCTGTTTTTGACTCCCCGGCTTTATGATTTCAACAAAACCAGGAAGCCTGATCCCACTTTGAGCAGAACACAACTGAAGATACTCCAGAAATCATGTCCTCGA
GGTGGAAATAGGACAGCTCTCACCAACCTAGACCCAACAACAGTGAATACATTTGACAACAGATACTTCTCCAACCTGCAAGCAAGTGCAGGCCTGCTTCAAAGTGATCAGGAGCTGTTT
TCAACTCCAAAGTCAAATACAGTGGAGATGGTTAACCAATTCAGTGCCAACCAGACAGCTTTCTTTGAAAGCTTTGTAGCTTCCATGATTAAGATGATCAGTTATATTAGTGTTCTAACT
GGGATGGAGGGGGAAGTGAGGACTCGTTGTCGAAGAGTGAATAATATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATGTTGTGGTACGTACTGGTCCTTTCAAGGGAAACATTTCTGGTTGCAATCCAAAAACTGTATGTGACGACGAAAATTTTGGAGGCCCTTCTTGGGGGAGCTTTCTAGGAAGAAAG
GATGGCCTCACAGCTAGCCAAACTGGTGCAAATAAGGCCCTTCCAAGTGCATTTGATCCCCTCATTGCGATTGCATCCAAATTTGCTGCTGTTGGACTAGACAGTAGAGACCTCGTGGCG
TT
GTGCCCATTCATTTGGCCTCGGAGTCTGTTTTTGACTCCCCGGCTTTATGATTTCAACAAAACCAGGAAGCCTGATCCCACTTTGAGCAGAACACAACTGAAGATACTCCAGAAATCA
TGTCCTCGAGGTGGAAATAGGACAGCTCTCACCAACCTAGACCCAACAACAGTGAATACATTTGACAACAGATACTTCTCCAACCTGCAAGCAAGTGCAGGCCTGCTTCAAAGTGATCAG
GAGCTGTTTTCAACTCCAAAGTCAAATACAGTGGAGATGGTTAACCAATTCAGTGCCAACCAGACAGCTTTCTTTGAAAGCTTTGTAGCTTCCATGATTAAGATGATCAGTTATATTAGT
GTTCTAACTGGGATGGAGGGGGAAGTGAGGACTCGTTGTCGAAGAGTGAATAATATTTAA

Retrieve as FASTA