Entry information : MtPrx03 (Medtr3g467600.1[4.0])
Entry ID 330
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2014-07-15 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-15 (Christophe Dunand)
Peroxidase information: MtPrx03 (Medtr3g467600.1[4.0])
Name (synonym) MtPrx03 (Medtr3g467600.1[4.0])
Class Class III peroxidase     [Orthogroup: Prx012]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots nodules
Inducer Rhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx03
start..stop
S start..stop
GmPrx13 456 7e-163 1..324 1..322
MtPrx01 426 3e-151 10..323 10..324
PvPrx10 422 1e-149 10..324 14..327
MtPrx86 419 2e-148 5..324 4..321
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27886204..27886419 216 N° 2 27886841..27887035 195 N° 3 27887854..27888417 564  
join(27886204..27886419,27886841..27887035,27887854..27888417)


exon

Literature and cross-references MtPrx03 (Medtr3g467600.1[4.0])
Literature Fedorova,M. et al., unpublished,
Watson,B.S. et al., unpublished
DNA ref. Phytozome 12:   chr3 (27886204..27888417)
Cluster/Prediction ref. Phytozome Gene 12:   31053456 UniGene:   Mtr.16537
Omic ref. Gene atlas:   Mtr.2906.1.S1_at   Mtr.40875.1.S1_at Legoo:   Mtr.40875.1.S1_at
Protein sequence: MtPrx03 (Medtr3g467600.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   324 (299)
PWM (Da):   %s   35985.83 (33035.4)  
PI (pH):   %s   5.35 (4.90) Peptide Signal:   %s   cut: 26 range:26-324
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFHHIQYYFIVLLMATFLTTHSNAELTPDFYNDVCPQALSIINTIVRQKLDFKPRMGAHLLRLHFHDCFVNGCDGSVLLDDTPNFIGEKTAKGNIDSLKGFMLVDIIKAELDKACKGPVVSCADILAVIARDSVSILGGPSYWYQVLLGRRDARNASMKDAESYLPSQLFNLSQLVSNFESQGLNLKDLVALSGAHTIGMAKCSTFRERIYNDTNIDPDFATCLQDNCPLHGGDDNFEALDFLTPQVFDNSYYKNLVSKIGLFHSDQELFKGDGSESDMLVELYSRDSDAFARDFKASMIKMGNIKPLTGNFGEIRTYCGKVN*

Retrieve as FASTA  
Remarks Complete sequence from 15 ESTs and genomic (chromo 3, introns 1 and 2).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCATCACATCCAATATTATTTCATTGTTCTCTTAATGGCCACATTTCTTACAACTCATTCCAATGCAGAACTAACACCTGATTTTTACAACGATGTTTGCCCTCAAGCATTG
TCTATCATTAACACAATTGTTCGACAAAAACTTGATTTTAAACCACGTATGGGAGCACATTTACTAAGGTTGCATTTCCATGACTGTTTTGTCAAT
GTAAGTTAATTATACACCCAACAA
CACTTACACATATATACAAAGATGTATTTGCAATAATATAATCCGAACCACGCTTCGAATGCATTAAAAAATAGTCATGCTAGCTATTGCACCAATTTTTTTTTATATATATACCAGCGT
TCAGACCGACCAACACTTCTATGTTATTCTTTCCGTTTTTTTTTCAAGTATTGAATTATTTTTTTCCGAAGGAAAGACTGTGCATCGAAATTAATCTCATAATTAATTAAGCACCAAGAC
ATAAACTTGTAATAAACAACTTAGCATATTTCATGTGATCTTATGTCACTTCTAGTTCTATATCCTATAGTTTTCATTTGTTCATATATTATTATTATTATTATTATTATTATTCCCTTA
AATGACTATGGTTATAATAATAAAATTAAATTTACAGGGGTGTGATGGATCAGTTCTGCTGGATGACACTCCTAACTTCATAGGTGAAAAGACTGCCAAAGGAAATATTGATTCACTTAA
AGGCTTTATGCTTGTTGATATAATTAAAGCAGAACTTGACAAAGCTTGCAAAGGCCCTGTGGTATCATGTGCAGATATCTTAGCAGTAATTGCTCGTGATTCTGTGTCCATT
GTAAGAAG
AATTAATCCTACATTTATCTCAGTTATATGGTTATGGTTATTTATATATAGATCTCTATTTAGAATTTTTTAAATTGGTCTTTAGATTAACATAATTTATAAATAAATTTCTAAACATGT
TAATAGTTCATATAGTGAATACTCATTTTAATCTCTAAAAAAAATTATGAGATTCAATTTGAGTCTTAAGAAAATTAAAATCTACTTTTTAGTCATTGAAAAAATAAATCGAGACAATTA
GTCCCTTTTTGAACTACTATCCGTCATAAAGTTGAGTTCATTTTATGGTGATATTGTTTCAAAAGAGACAATTAAGTCTTGACAGTAATTAAAATACGACAATTTTGTCTCCGTATATAA
TTAAAAGTGATATATTGGAACTCATTTGGGGTTGATCTAGTGGTTGGCTTGAGATATTGGAGTGTGCTTCTCTCAATGTCTTAGGTTCGATTCCTCCTTATGTCAATTTTGGTGGGCTAA
GTCCATACGCAGCTATGCTTTGCCTTTAAATGAGAGCTCCCGTAAGTGGGTGGTAGGATTGGTCTAATCGGATTAGTCGGTTCTTAGATCGGATACCGAATTAAAAAAAAAAGTGACATA
TGGTTCTTATAAAATAAAAAAGCCGGTGGTTTATGTAGGGTCTAAGTTGTCTCCATTTATTTTTATCAAAGATTAAAAAGTTATTTTTATTTTTCTCAGGGGCCAAATTTTATCTAGTTT
TTCTCATACACTAAACTTCTTTCTATAAAAATACCAAGTTGGACATAAAAAATGATGTACACATAACTTTGTTTTTTTTTGGTTTAATAGTTAGGAGGTCCAAGCTATTGGTACCAAGTG
CTACTAGGAAGAAGAGATGCAAGAAATGCTTCAATGAAAGATGCAGAATCATATCTTCCTTCACAACTTTTCAATCTTTCACAACTTGTTTCTAACTTTGAGTCTCAAGGCCTAAACCTT
AAAGATCTTGTAGCACTTTCTGGTGCTCACACAATTGGAATGGCTAAGTGTTCTACCTTTAGGGAAAGGATTTACAATGACACCAATATAGACCCTGACTTTGCAACATGCTTACAAGAT
AATTGTCCTTTACATGGTGGTGATGACAATTTTGAAGCATTGGATTTTCTCACTCCTCAAGTATTTGATAATTCTTACTACAAAAATTTGGTTAGTAAAATAGGTCTCTTCCATTCTGAT
CAAGAACTCTTTAAGGGAGATGGAAGTGAAAGTGATATGTTGGTGGAACTTTATAGTAGAGACTCAGATGCTTTTGCAAGAGATTTTAAAGCTTCCATGATTAAGATGGGTAATATAAAG
CCTCTTACTGGAAACTTTGGAGAGATTAGAACCTATTGTGGAAAAGTTAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTTCATCACATCCAATATTATTTCATTGTTCTCTTAATGGCCACATTTCTTACAACTCATTCCAATGCAGAACTAACACCTGATTTTTACAACGATGTTTGCCCTCAAGCATTG
TCTATCATTAACACAATTGTTCGACAAAAACTTGATTTTAAACCACGTATGGGAGCACATTTACTAAGGTTGCATTTCCATGACTGTTTTGTCAAT
GGGTGTGATGGATCAGTTCTGCTG
GATGACACTCCTAACTTCATAGGTGAAAAGACTGCCAAAGGAAATATTGATTCACTTAAAGGCTTTATGCTTGTTGATATAATTAAAGCAGAACTTGACAAAGCTTGCAAAGGCCCTGTG
GTATCATGTGCAGATATCTTAGCAGTAATTGCTCGTGATTCTGTGTCCATT
TTAGGAGGTCCAAGCTATTGGTACCAAGTGCTACTAGGAAGAAGAGATGCAAGAAATGCTTCAATGAAA
GATGCAGAATCATATCTTCCTTCACAACTTTTCAATCTTTCACAACTTGTTTCTAACTTTGAGTCTCAAGGCCTAAACCTTAAAGATCTTGTAGCACTTTCTGGTGCTCACACAATTGGA
ATGGCTAAGTGTTCTACCTTTAGGGAAAGGATTTACAATGACACCAATATAGACCCTGACTTTGCAACATGCTTACAAGATAATTGTCCTTTACATGGTGGTGATGACAATTTTGAAGCA
TTGGATTTTCTCACTCCTCAAGTATTTGATAATTCTTACTACAAAAATTTGGTTAGTAAAATAGGTCTCTTCCATTCTGATCAAGAACTCTTTAAGGGAGATGGAAGTGAAAGTGATATG
TTGGTGGAACTTTATAGTAGAGACTCAGATGCTTTTGCAAGAGATTTTAAAGCTTCCATGATTAAGATGGGTAATATAAAGCCTCTTACTGGAAACTTTGGAGAGATTAGAACCTATTGT
GGAAAAGTTAACTAA

Retrieve as FASTA