Entry information : PpaPrx51 (PP00256G00520)
Entry ID 3300
Creation 2010-01-27 (Christophe Dunand)
Last sequence changes 2014-01-16 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-01-16 (Qiang Li)
Peroxidase information: PpaPrx51 (PP00256G00520)
Name (synonym) PpaPrx51 (PP00256G00520)
Class Class III peroxidase    [Orthogroup: Prx063]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx51
start..stop
S start..stop
PpaPrx55 649 0 1..321 1..321
PpaPrx29 512 0 1..321 1..323
PpaPrx31 437 9e-156 1..320 1..326
PpaPrx14 338 2.17e-116 21..320 33..337
Gene structure Fichier Exons


exon

Literature and cross-references PpaPrx51 (PP00256G00520)
DNA ref. Phytozome 12:   scaffold_256 (618373..616249)
Protein sequence: PpaPrx51 (PP00256G00520)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (302)
PWM (Da):   %s   33854.87 (31846.7) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.15 (6.86) Peptide Signal:   %s   cut: 20 range:20-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRWPSPALLAIFVTIALAMNSITPAAAHTGLKVGFYRHSCPQVEAIVYNSMAQSTKADDTVAPGILRMAFHDCFVRGCDASVLLEGPNTERRARTNTGLHGFDAIDAAKRAVENACPGV
VSAADVLQFAARTxxxQAGGYGWHVPAGRRDGTVSIMEEALNLPAPSMTVSQLIDVFGRKGLSPSQMVVLSGAHTIGKAPCVTFDDRVQTTPVDPTLAPSFATFLKGQCPYAAIQSTSVD
MDSTAHTFDSQYFKDIIAGRGLLTSDQSLLYDSRTSGGVYANNGAAFYRNFAKAMVKMSQIEVLTGLDGEIRRQFDQVNSH

Retrieve as FASTA  
Remarks Complete sequence from genomic. Short PS is missing due to the NNNN in DNA. the beginning and the end of intron 2 is missing. Missing 'c'.
DNA
Send to BLAST