Entry information : SmPrx57-1_5 (SmPrx57a_5)
Entry ID 3323
Creation 2009-11-09 (Paula Nunes)
Last sequence changes 2009-11-09 (Paula Nunes)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrx57-1_5 (SmPrx57a_5)
Name (synonym) SmPrx57-1_5 (SmPrx57a_5)
Class Class III peroxidase    [Orthogroup: Prx285]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrx57-1_5
start..stop
S start..stop
SmPrx57-2_33 664 0 1..330 1..330
SmPrx80-1_13 375 6e-131 17..326 18..324
SmPrx80-2_66 373 3e-130 19..326 13..318
PabPrx102 345 2e-119 11..326 3..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3720884..3721102 219 N° 2 3720618..3720812 195 N° 3 3720379..3720544 166 N° 4 3719908..3720320 413
complement(join(3719908..3720320,3720379..3720544,3720618..3720812,3720884..3721 102))


exon

Literature and cross-references SmPrx57-1_5 (SmPrx57a_5)
Literature Weng,J.-K., Tanurdzic,M. and Chapple,C. Functional analysis and comparative genomics of expressed sequence tags from the lycophyte Selaginella moellendorffii. BMC Genomics 6 (1), 85 (2005)
DNA ref. Phytozome 12:   scaffold_5 (3721102..3719908)
EST ref. GenBank:   DN838122 [3' end]   FE464316.1 [Fragment]   FE487998.1 [Fragment]
Protein sequence: SmPrx57-1_5 (SmPrx57a_5)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (306)
PWM (Da):   %s   35844.19 (33399.9)  
PI (pH):   %s   5.27 (5.26) Peptide Signal:   %s   cut: 25 range:25-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPACEILVMVSLLKASLVVFSAAADKLELGYYSETCPNLEEILATSAKLKLAEAPTTPAAVVRLLFHDCFIEGCDASIMITSTPDNLAERDAEVNRDLAGDGFDAVVRAKAAVEAECPGVVSCADILVIIARNFIELTGGPSYPVLKGRKDGFISEAARVQDNLPGSTLNLHQLLRNFKSKGLDMEDLVVLSGAHTFGFAHCKQFHKRLYNFSRDRAMDPRLPPVFASSLKAACPERGDDPGLVLPFDPSTPFAFDNSYYKTLVAGNALLISDETLLAKRKTREMIREFARDEQKFYQEFGAAMQRLSSVGVKVGSDGDVRRDCTAFDR

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 3 EST. Contig also contains 3 other Prx
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCAGCGTGTGAGATTTTGGTAATGGTTTCCTTGTTGAAGGCTTCGTTGGTGGTTTTTAGCGCAGCAGCAGATAAACTCGAGCTCGGCTATTACTCCGAGACGTGTCCAAATTTG
GAAGAGATCCTCGCAACCTCTGCTAAACTTAAGCTGGCCGAAGCACCCACGACTCCTGCGGCTGTTGTGAGGCTCTTGTTCCACGACTGCTTCATAGAG
GTAAGTCCGATTTTCTCGTTT
CTCTGCTTTTTATTTTTCGATCTTGTGATGATCTTGTTTGCATGGTGCAGGGATGCGATGCCTCGATCATGATAACTTCTACTCCGGACAACTTGGCTGAAAGAGACGCGGAAGTTAACA
GGGACTTGGCTGGTGATGGTTTTGATGCCGTGGTTCGAGCAAAGGCGGCGGTGGAAGCCGAGTGCCCGGGAGTGGTGTCTTGTGCTGACATCTTGGTGATCATAGCGAGAAACTTCATAG
AGCTG
GTAAGATTAAGTTTCATTAGTTCTCATGCAATTCTAGCTTCCAGGTTGATCAAAAGGTCTTTTTGATTGACAGACTGGTGGGCCTTCGTATCCTGTTCTCAAGGGAAGAAAAGAT
GGATTTATCTCCGAGGCCGCGAGGGTCCAGGACAACCTTCCAGGCTCCACCTTGAATCTCCATCAACTTTTACGCAACTTTAAGAGCAAAGGACTGGACATGGAAGATCTCGTGGTACTG
AGTG
GTAAGCTCTCAAAGCTTTTCATCTAAAAGCTCGAAAAGTTTCATGGATTCCTCCCTAGGTGCTCACACTTTTGGATTCGCTCACTGCAAGCAATTCCACAAGAGGCTCTACAACTT
TAGCCGCGATCGCGCAATGGATCCGAGGCTCCCTCCGGTTTTCGCGTCGAGCCTCAAGGCCGCCTGTCCCGAGCGTGGCGATGATCCAGGCTTGGTGCTGCCCTTCGATCCCTCCACTCC
ATTCGCCTTCGACAACTCCTACTACAAGACCCTCGTCGCTGGAAACGCGCTGCTCATCTCGGACGAGACGCTCCTCGCCAAGCGCAAGACGAGGGAGATGATCAGGGAATTCGCGAGAGA
CGAGCAAAAGTTCTACCAGGAATTTGGCGCCGCGATGCAAAGACTGTCGAGCGTTGGAGTGAAGGTTGGGAGCGATGGCGACGTGAGGAGAGATTGCACGGCTTTTGATCGGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGCCAGCGTGTGAGATTTTGGTAATGGTTTCCTTGTTGAAGGCTTCGTTGGTGGTTTTTAGCGCAGCAGCAGATAAACTCGAGCTCGGCTATTACTCCGAGACGTGTCCAAATTTG
GAAGAGATCCTCGCAACCTCTGCTAAACTTAAGCTGGCCGAAGCACCCACGACTCCTGCGGCTGTTGTGAGGCTCTTGTTCCACGACTGCTTCATAGAG
GGATGCGATGCCTCGATCATG
ATAACTTCTACTCCGGACAACTTGGCTGAAAGAGACGCGGAAGTTAACAGGGACTTGGCTGGTGATGGTTTTGATGCCGTGGTTCGAGCAAAGGCGGCGGTGGAAGCCGAGTGCCCGGGA
GTGGTGTCTTGTGCTGACATCTTGGTGATCATAGCGAGAAACTTCATAGAGCTG
ACTGGTGGGCCTTCGTATCCTGTTCTCAAGGGAAGAAAAGATGGATTTATCTCCGAGGCCGCGAGG
GTCCAGGACAACCTTCCAGGCTCCACCTTGAATCTCCATCAACTTTTACGCAACTTTAAGAGCAAAGGACTGGACATGGAAGATCTCGTGGTACTGAGTG
GTGCTCACACTTTTGGATTC
GCTCACTGCAAGCAATTCCACAAGAGGCTCTACAACTTTAGCCGCGATCGCGCAATGGATCCGAGGCTCCCTCCGGTTTTCGCGTCGAGCCTCAAGGCCGCCTGTCCCGAGCGTGGCGAT
GATCCAGGCTTGGTGCTGCCCTTCGATCCCTCCACTCCATTCGCCTTCGACAACTCCTACTACAAGACCCTCGTCGCTGGAAACGCGCTGCTCATCTCGGACGAGACGCTCCTCGCCAAG
CGCAAGACGAGGGAGATGATCAGGGAATTCGCGAGAGACGAGCAAAAGTTCTACCAGGAATTTGGCGCCGCGATGCAAAGACTGTCGAGCGTTGGAGTGAAGGTTGGGAGCGATGGCGAC
GTGAGGAGAGATTGCACGGCTTTTGATCGGTAG

Retrieve as FASTA