Entry information : SmAPx01-1_0 (SmAPx01a_0 / Selmo1_0-PACid_15418073)
Entry ID 3324
Creation 2010-02-09 (Christophe Dunand)
Last sequence changes 2010-02-09 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-12-09 (Christophe Dunand)
Peroxidase information: SmAPx01-1_0 (SmAPx01a_0 / Selmo1_0-PACid_15418073)
Name (synonym) SmAPx01-1_0 (SmAPx01a_0 / Selmo1_0-PACid_15418073)
Class Ascorbate peroxidase    [Orthogroup: APx001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation Cytosolic
Tissue type Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmAPx01-1_0
start..stop
S start..stop
SmAPx01-2_8 514 0 1..250 1..250
IpAPx 426 1e-153 1..249 1..249
AaAPx02 425 4e-153 1..249 1..249
NtAPx03-1A 424 8e-153 1..249 1..249
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2241373..2241457 85 N° 2 2241268..2241301 34 N° 3 2241021..2241195 175 N° 4 2240827..2240892 66
N° 5 2240617..2240751 135 N° 6 2240476..2240555 80 N° 7 2240318..2240420 103 N° 8 2240182..2240256 75
complement(join(2240182..2240256,2240318..2240420,2240476..2240555,2240617..2240 751,2240827..2240892,2241021..2241195,2241268..2241301,2241373..2241457))


exon

Literature and cross-references SmAPx01-1_0 (SmAPx01a_0 / Selmo1_0-PACid_15418073)
Literature Weng,J.-K., Tanurdzic,M. and Chapple,C. Functional analysis and comparative genomics of expressed sequence tags from the lycophyte Selaginella moellendorffii. BMC Genomics 6 (1), 85 (2005
DNA ref. Phytozome 12:   scaffold_0 (2241457..2240182)
mRNA ref. JGI transcript:   270176
EST ref. GenBank:   DN839337   FE505259.1
Protein sequence: SmAPx01-1_0 (SmAPx01a_0 / Selmo1_0-PACid_15418073)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27417.93  
PI (pH):   %s   6.24
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKSYPAVSEEYKAAVEKAKRKLRGFIAEKNCAPLMLRLAWHSAGTYDCQSKTGGPFGTMKLAEELGHTANNGLDIAVKLLQPIKDQFPILSYGDFYLAGVVAVEVTGGPEIPFHPGRVDKPTCPMEGRLPDATKGADHLRDVFVKHMGLTDKDIVALSGGHTLGRAHKERSGFEGPWTHNPLQFDNSYFTILLSGEQEGILTLPTDKVLVEDPSFRPLVELYADEEAFFKDYTEAHLKLSELGFAEE*

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns and extra introns in 5'UTR), ESTs (FE436893.1, FE474871.1, FE468290.1, DN838255) and RNA seq.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAATCTTACCCGGCCGTGAGCGAGGAGTACAAGGCCGCCGTGGAGAAGGCCAAGAGGAAGCTCCGCGGCTTCATCGCAGGCAAGATCGGCGGATCGAAGCTTGAAAATTTCTAG
TCTTTCTGACCCTTTGTTTCCGATCTTTTCTCGCAGAGAAGAACTGTGCGCCATTGATGCTCCGCCTTGCGTAAGTCTCTTGTCCTCTTTTTCTTTGGTTTCGCCTCTTCTTGTAAAGCT
CACGGCTCGCTTTGTGGAATAGATGGCACTCGGCGGGAACTTACGATTGCCAGTCCAAGACCGGTGGTCCTTTTGGCACCATGAAGCTCGCTGAGGAGCTTGGCCATACCGCGAACAATG
GTCTCGACATCGCCGTGAAGCTGCTACAGCCAATCAAGGACCAGTTCCCCATCTTGAGCTATGGCGACTTCTATCAG
GTCCTTTGTTTGCTTTCCTTCGTTTGGTTTTTCCCTTTAGTGC
TGTGACGCTACCTATCTCGAAAGATAGTGTCTGGAATTAGTGCCATTTCGATAAGACTTGGTTCTTATAGATTATTTTTTTACAGCTTGCGGGAGTCGTTGCTGTGGAAGTCACTGGTGG
CCCCGAGATTCCATTCCATCCCGGGAGAGTG
GTGAGTTTTGATATTCGATTTTCAATTGGTTTCTCGTGGAATGATGTAACCAAGCAATGCCTTGGATGGATACAGGACAAGCCAACATG
CCCAATGGAGGGACGGCTTCCAGATGCTACCAAGGGCGCGGATCATCTCAGAGACGTGTTTGTGAAGCATATGGGTCTCACGGACAAGGACATCGTGGCTCTCTCTGGCGGTCACACTCT
G
GTAAGCTGTATCAGTCTCAGAGAAGAAAAAAATCTTACGAAACTTCGGTGTGTTTGTCCAGGGAAGAGCACACAAGGAACGATCCGGGTTTGAGGGCCCATGGACGCACAACCCTCTCC
AGTTTGACAACTCCTACTTCAC
GTAAGCCGATCGATTTCACTTTTCTTTCTTTCCGATGTAATCGTGTTTGCTCCAGGATACTGCTGAGCGGTGAGCAGGAAGGCATCCTCACTCTCCCA
ACCGACAAAGTTCTCGTGGAGGATCCCTCATTCCGCCCGCTCGTGGAGCTCTACGCCAAG
GTAAAGAGAAATCTCCGCTTAGAACTCTGCGTGATCAAGAGATAAATTTCGCTTGGAACA
GGACGAGGAGGCGTTCTTCAAGGATTACACCGAAGCCCACCTCAAGCTCTCGGAGCTTGGATTCGCCGAGGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAATCTTACCCGGCCGTGAGCGAGGAGTACAAGGCCGCCGTGGAGAAGGCCAAGAGGAAGCTCCGCGGCTTCATCGCAGAGAAGAACTGTGCGCCATTGATGCTCCGCCTTGCA
TGGCACTCGGCGGGAACTTACGATTGCCAGTCCAAGACCGGTGGTCCTTTTGGCACCATGAAGCTCGCTGAGGAGCTTGGCCATACCGCGAACAATGGTCTCGACATCGCCGTGAAGCTG
CTACAGCCAATCAAGGACCAGTTCCCCATCTTGAGCTATGGCGACTTCTATCAG
CTTGCGGGAGTCGTTGCTGTGGAAGTCACTGGTGGCCCCGAGATTCCATTCCATCCCGGGAGAGTG
GACAAGCCAACATGCCCAATGGAGGGACGGCTTCCAGATGCTACCAAGGGCGCGGATCATCTCAGAGACGTGTTTGTGAAGCATATGGGTCTCACGGACAAGGACATCGTGGCTCTCTCT
GGCGGTCACACTCTG
GGAAGAGCACACAAGGAACGATCCGGGTTTGAGGGCCCATGGACGCACAACCCTCTCCAGTTTGACAACTCCTACTTCACGATACTGCTGAGCGGTGAGCAGGAA
GGCATCCTCACTCTCCCAACCGACAAAGTTCTCGTGGAGGATCCCTCATTCCGCCCGCTCGTGGAGCTCTACGCCAAG
GACGAGGAGGCGTTCTTCAAGGATTACACCGAAGCCCACCTC
AAGCTCTCGGAGCTTGGATTCGCCGAGGAGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAAT CTTACCCGGC CGTGAGCGAG GAGTACAAGG CCGCCGTGGA GAAGGCCAAG AGGAAGCTCC GCGGCTTCAT CGCAGAGAAG AACTGTGCGC CATTGATGCT CCGCCTTGCA  TGGCACTCGG CGGGAACTTA CGATTGCCAG TCCAAGACCG GTGGTCCTTT TGGCACCATG AAGCTCGCTG AGGAGCTTGG CCATACCGCG AACAATGGTC TCGACATCGC CGTGAAGCTG  CTACAGCCAA TCAAGGACCA GTTCCCCATC TTGAGCTATG GCGACTTCTA TCAGCTTGCG GGAGTCGTTG CTGTGGAAGT CACTGGTGGC CCCGAGATTC CATTCCATCC CGGGAGAGTG  GACAAGCCAA CATGCCCAAT GGAGGGACGG CTTCCAGATG CTACCAAGGG CGCGGATCAT CTCAGAGACG TGTTTGTGAA GCATATGGGT CTCACGGACA AGGACATCGT GGCTCTCTCT  GGCGGTCACA CTCTGGGAAG AGCACACAAG GAACGATCCG GGTTTGAGGG CCCATGGACG CACAACCCTC TCCAGTTTGA CAACTCCTAC TTCACGATAC TGCTGAGCGG TGAGCAGGAA  GGCATCCTCA CTCTCCCAAC CGACAAAGTT CTCGTGGAGG ATCCCTCATT CCGCCCGCTC GTGGAGCTCT ACGCCAAGGA CGAGGAGGCG TTCTTCAAGG ATTACACCGA AGCCCACCTC 
AAGCTCTCGG AGCTTGGATT CGCCGAGGAG TAA 

Retrieve as FASTA