Entry information : SmPrxII06-2_8 (SmPrxIIFb_8)
Entry ID 3325
Creation 2007-09-21 (Christophe Dunand)
Last sequence changes 2007-09-21 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2011-01-25 (Toky Ramarohetra (Scipio))
Peroxidase information: SmPrxII06-2_8 (SmPrxIIFb_8)
Name (synonym) SmPrxII06-2_8 (SmPrxIIFb_8)
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Isoetopsida Selaginellaceae Selaginella
Organism Selaginella moellendorffii    [TaxId: 88036 ]
Cellular localisation N/D
Tissue type Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SmPrxII06-2_8
start..stop
S start..stop
SmPrxII06-1_0 384 4.52e-139 1..188 1..188
MpPrxII04 253 4.49e-87 14..187 19..195
PpaPrxII06 242 8.17e-83 17..187 28..198
VvPrxII06 238 5.34e-81 3..187 7..199
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3325' 'join(2035545..2035718,2035889..2035918,2036026..2036184,2036248..2036342,2036400..2036508)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2035545..2035718 172 N° 2 2035889..2035918 28 N° 3 2036026..2036184 157 N° 4 2036248..2036342 93
N° 5 2036400..2036508 107  
join(2035545..2035718,2035889..2035918,2036026..2036184,2036248..2036342,2036400 ..2036508)


exon

Literature and cross-references SmPrxII06-2_8 (SmPrxIIFb_8)
Literature Weng,J.-K., Tanurdzic,M. and Chapple,C. Functional analysis and comparative genomics of expressed sequence tags from the lycophyte Selaginella moellendorffii. BMC Genomics 6 (1), 85 (2005
DNA ref. Phytozome 12:   scaffold_8 (2035545..2036508)
mRNA ref. JGI transcript:   87529  68725 [Incorrect prediction]
EST ref. GenBank:   DN839286.1
Protein sequence: SmPrxII06-2_8 (SmPrxIIFb_8)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   188
PWM (Da):   %s   20488.68  
PI (pH):   %s   9.23
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRQRALRIQSTLSARSRSVVTVSSSLDLDSDLALQEARTWDQGLESQFATTPLSQIFKDKRVVIFGTPGAFTGVCTKGHVPSYTKNVEQLKSKGVDSVICVAVNDPYTINAWAEKMNAKG
K
IQFFADFDGGFHKSLGLECDLSKALLGLRSQRWSAFVDDGVVKVLKVEKVPSELKVSDGETMIKAIH

Retrieve as FASTA  
Remarks Complete sequence from genomic (4 introns) and 1 EST.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAACGAGCGCTGCGGATCCAATCCACATTGTCCGCGCGCTCGAGGTCCGTCGTCACAGTCTCTTCCAGCCTCGACTTAGATTCCGACCTCGCATTACAGGAAGCGCGGACCTGG
GACCAGGGTCTCGAATCCCAGTTCGCCACAACGCCGCTCTCCCAGATTTTCAAG
AGGTCAGTATTGCTATTTTGCATTCGCTAGCAATACGTTAATCTTGCTATGAACTTTCATGAGTTC
TTGTGCTAGTATCTCATCAATCCCTTAGACAAAGTCTTCTAGCTCTAGACATTTAGAAGTTTCCTGTTCTCTTCATGTTCTCTTATCCCCTTTTTTTGTCTTTCAGGACAAGCGTGTTGT
CATCTTCGGTACTCCA
CAGTAAGTTATTCTTTCGTCTTTGTTGTTCTTCGAGGAAACAAGCAAAACTAAACAGAAGAAGAAGAAAAAAGAGATCGTAACTTACAATTCACTCCATTTCCA
TTCAGGGCGCGTTCACGGGTGTTTGCACAAAGGGTCACGTCCCCAGCTACACCAAGAACGTCGAGCAGCTGAAATCCAAGGGCGTCGACTCCGTCATCTGCGTCGCGGTGAACGACCCCT
ACACCATCAACGCCTGGGCCGAGAAGATGAACGCAAAAGGCAAG
AGGTTAGCTTTCTTTTTCCTTCTCCTCTACGTGCGCTTATTTCTAAGAGTTTGGAACGCTCCCAGATCCAGTTCTT
CGCCGATTTTGACGGTGGCTTCCACAAATCTCTGGGCTTGGAGTGTGATTTGAGCAAGGCGCTGCTTGGCCTTCGTTCGCAGAG
AGGTGGAGAAATCTCTTTCGGTATTTGCTTTTGACA
TTCTTGAGAAATAAACTACGCAGGTGGTCAGCATTTGTGGACGATGGTGTGGTGAAAGTCCTCAAGGTGGAAAAGGTTCCTTCGGAGCTCAAGGTTAGCGATGGCGAGACGATGATCAAA
GCCATCCATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAACGAGCGCTGCGGATCCAATCCACATTGTCCGCGCGCTCGAGGTCCGTCGTCACAGTCTCTTCCAGCCTCGACTTAGATTCCGACCTCGCATTACAGGAAGCGCGGACCTGG
GACCAGGGTCTCGAATCCCAGTTCGCCACAACGCCGCTCTCCCAGATTTTCAAG
GACAAGCGTGTTGTCATCTTCGGTACTCCAGGCGCGTTCACGGGTGTTTGCACAAAGGGTCACGTC
CCCAGCTACACCAAGAACGTCGAGCAGCTGAAATCCAAGGGCGTCGACTCCGTCATCTGCGTCGCGGTGAACGACCCCTACACCATCAACGCCTGGGCCGAGAAGATGAACGCAAAAGGC
AAG
ATCCAGTTCTTCGCCGATTTTGACGGTGGCTTCCACAAATCTCTGGGCTTGGAGTGTGATTTGAGCAAGGCGCTGCTTGGCCTTCGTTCGCAGAGGTGGTCAGCATTTGTGGACGAT
GGTGTGGTGAAAGTCCTCAAGGTGGAAAAGGTTCCTTCGGAGCTCAAGGTTAGCGATGGCGAGACGATGATCAAAGCCATCCATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCGGCAAC GAGCGCTGCG GATCCAATCC ACATTGTCCG CGCGCTCGAG GTCCGTCGTC ACAGTCTCTT CCAGCCTCGA CTTAGATTCC GACCTCGCAT TACAGGAAGC GCGGACCTGG  GACCAGGGTC TCGAATCCCA GTTCGCCACA ACGCCGCTCT CCCAGATTTT CAAGGACAAG CGTGTTGTCA TCTTCGGTAC TCCAGGCGCG TTCACGGGTG TTTGCACAAA GGGTCACGTC  CCCAGCTACA CCAAGAACGT CGAGCAGCTG AAATCCAAGG GCGTCGACTC CGTCATCTGC GTCGCGGTGA ACGACCCCTA CACCATCAAC GCCTGGGCCG AGAAGATGAA CGCAAAAGGC  AAGATCCAGT TCTTCGCCGA TTTTGACGGT GGCTTCCACA AATCTCTGGG CTTGGAGTGT GATTTGAGCA AGGCGCTGCT TGGCCTTCGT TCGCAGAGGT GGTCAGCATT TGTGGACGAT 
GGTGTGGTGA AAGTCCTCAA GGTGGAAAAG GTTCCTTCGG AGCTCAAGGT TAGCGATGGC GAGACGATGA TCAAAGCCAT CCATTAA 

Retrieve as FASTA