Entry information : PpaPrx03
Entry ID 3326
Creation 2008-08-06 (Christophe Dunand)
Last sequence changes 2011-03-03 (Nizar Fawal)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-05 (Qiang Li)
Peroxidase information: PpaPrx03
Name PpaPrx03
Class Class III peroxidase    [Orthogroup: Prx149]
Taxonomy Eukaryota Viridiplantae Streptophyta Funariaceae Physcomitrella
Organism Physcomitrella patens    [TaxId: 3218 ]
Cellular localisation N/D
Tissue types Buds
Chloronemata
Gametophore
Mixed tissues
Shoot tips
Sporophyte
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PpaPrx03
start..stop
S start..stop
PpaPrx16 514 0 1..325 1..325
PpaPrx10 428 9e-152 14..325 21..328
PpaPrx08 355 5e-123 1..325 1..321
SmPrx35-1_84 298 1e-100 33..325 22..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1442628..1442873 246 N° 2 1443073..1443252 180 N° 3 1443365..1443530 166 N° 4 1443631..1444025 395
join(1442628..1442873,1443073..1443252,1443365..1443530,1443631..1444025)


exon

Literature and cross-references PpaPrx03
Literature Kuroki,Y., Toyoda,A., Sakaki,Y., Tanahashi,T., Nishiyama,T.,
Hiwatashi,Y., Suzuki,Y., Sugano,S., Fujiyama,A. and Hasebe,M. Evolution of developmental genes in land plants. Unpublished (2006)
DNA ref. Phytozome 12:   scaffold_67 (1442628..1444025)
Cluster/Prediction ref. UniGene:   Ppa.5129
Protein sequence: PpaPrx03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   328 (300)
PWM (Da):   %s   35118.4 (31879.6) Transmb domain:   %s   i12-34o
PI (pH):   %s   5.39 (4.86) Peptide Signal:   %s   cut: 29 range:29-328
Sequence 369
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESRHNLLQRRPTLWTAVVLVILQLALSCWMCTVDALQTGYYAATCPNAEAIIRAAMERGMQEDSGTAPGVLRLHFHDCFVDGCDGSVLLDGPRSEKTASPNLTLRGYEVIDAAKADLELACSGIVSCADILAYAARDAVVLTGGLGWAVEAGRLDGRVSDAGRAFAEIPDPSFSSAQLAAVFARKGLTTSDMIVLSGAHSIGRAHCDSVKTRLYPVQDPNLREPLAAELRSGCPQQGGSATFSLDSTPNQFDNAYYIDVVNGRGIMRSDQALFDDPSTRTETMFNSLGAAPWAFRFGQIMVKMGQVGVKTGPDGEIRRNCRFVNTPI

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns) and 17 ESTs. No prediction from phytozome.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAGCAGACATAATTTGCTCCAGAGAAGACCCACTTTATGGACTGCGGTAGTCCTGGTGATATTGCAGCTGGCCCTTAGTTGCTGGATGTGCACTGTGGATGCGTTGCAAACGGGAT
ACTACGCAGCGACATGTCCAAATGCTGAAGCAATCATAAGAGCGGCTATGGAGAGGGGGATGCAAGAGGATTCTGGTACTGCACCGGGTGTGCTACGGCTCCACTTCCACGATTGTTTTG
TAGAT
GTAAGTTGTGACCATCGACAACCGGATGTCAATAGGTTTGATTATTGGGCAAATCTGAGCTCAAGTGGATGGGGAAACCTGAATTTGAGCAATGTTCTGTATAAAGTGGAAACAG
AGAGTTTATTTGAAAATTTGATTTTAATGTTGAAGAATTCGCGACAAGATTCATCATAGAGCTTCGTTGTATTGGCGTGCGAAGGGATGTGACGGATCAGTCCTCCTCGACGGGCCGAGA
TCGGAGAAAACAGCATCGCCCAACTTGACTTTGCGAGGATACGAGGTGATTGACGCAGCTAAGGCAGACCTGGAGTTAGCATGTTCGGGAATCGTTTCATGCGCGGATATTCTTGCGTAT
GCTGCTCGTGACGCTGTAGTATTG
GTAAGATTACGAAAGAGCTAACTAGTTCAACTCTCTGTTTCTGTTTCAGTTTTGATTACAATAGTCTGTCTCTCCACCGAACGGTATTTATACGAT
TCTTTTTATGTGAAAGACGGGAGGATTAGGGTGGGCAGTCGAAGCCGGCAGATTAGACGGTCGCGTTTCCGACGCCGGAAGAGCATTTGCTGAGATACCGGATCCAAGCTTCAGCTCTGC
CCAACTCGCGGCGGTGTTTGCTCGCAAGGGCTTGACAACCAGTGACATGATAGTCCTATCAG
GTAGCCATTCTCAGACTTTCGATCACAGATTCTCCGATTCCACCCACACCCCCTGTAA
CCGCATCTGAATTATCCGGATGCACAACTGAACGGCCTGCAGGTGCGCACTCCATCGGACGCGCCCACTGCGACTCCGTGAAGACTAGATTATACCCAGTTCAAGACCCCAACCTGAGGG
AGCCTCTCGCGGCAGAGCTGAGATCCGGATGCCCTCAGCAAGGCGGAAGCGCGACGTTCAGCTTGGATTCAACCCCCAACCAATTCGACAACGCTTACTATATCGACGTCGTAAACGGGA
GAGGCATCATGCGCTCCGATCAGGCCTTGTTCGACGACCCTTCCACCCGCACCGAAACCATGTTCAATTCCCTTGGCGCTGCTCCGTGGGCCTTCCGGTTCGGTCAAATTATGGTCAAGA
TGGGACAAGTCGGCGTCAAGACTGGCCCCGACGGCGAGATCCGCCGCAACTGCAGATTCGTAAACACACCGATCTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAGAGCAGACATAATTTGCTCCAGAGAAGACCCACTTTATGGACTGCGGTAGTCCTGGTGATATTGCAGCTGGCCCTTAGTTGCTGGATGTGCACTGTGGATGCGTTGCAAACGGGAT
ACTACGCAGCGACATGTCCAAATGCTGAAGCAATCATAAGAGCGGCTATGGAGAGGGGGATGCAAGAGGATTCTGGTACTGCACCGGGTGTGCTACGGCTCCACTTCCACGATTGTTTTG
TAGAT
GGATGTGACGGATCAGTCCTCCTCGACGGGCCGAGATCGGAGAAAACAGCATCGCCCAACTTGACTTTGCGAGGATACGAGGTGATTGACGCAGCTAAGGCAGACCTGGAGTTAG
CATGTTCGGGAATCGTTTCATGCGCGGATATTCTTGCGTATGCTGCTCGTGACGCTGTAGTATTG
ACGGGAGGATTAGGGTGGGCAGTCGAAGCCGGCAGATTAGACGGTCGCGTTTCCG
ACGCCGGAAGAGCATTTGCTGAGATACCGGATCCAAGCTTCAGCTCTGCCCAACTCGCGGCGGTGTTTGCTCGCAAGGGCTTGACAACCAGTGACATGATAGTCCTATCAG
GTGCGCACT
CCATCGGACGCGCCCACTGCGACTCCGTGAAGACTAGATTATACCCAGTTCAAGACCCCAACCTGAGGGAGCCTCTCGCGGCAGAGCTGAGATCCGGATGCCCTCAGCAAGGCGGAAGCG
CGACGTTCAGCTTGGATTCAACCCCCAACCAATTCGACAACGCTTACTATATCGACGTCGTAAACGGGAGAGGCATCATGCGCTCCGATCAGGCCTTGTTCGACGACCCTTCCACCCGCA
CCGAAACCATGTTCAATTCCCTTGGCGCTGCTCCGTGGGCCTTCCGGTTCGGTCAAATTATGGTCAAGATGGGACAAGTCGGCGTCAAGACTGGCCCCGACGGCGAGATCCGCCGCAACT
GCAGATTCGTAAACACACCGATCTAG

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTAGCTCA TTCTCTGCGG TATCTCAGTT CAACTTTCTA ACTCGTGGGT AGATAGATGC CAATTTATTT CTAGAGGTCT GTCGATTCGT TTTAGCACCG GACTGTCTGA GCGACTATCA  TTGTCCTTAA CAGCACCCGC GCAGTCTCTA CTGGTGCTGA ATCGACGAAG CGTTTTCGTG GCCCTTGAGA TACCAGACGA AATGGTCTGC ATGCGATGAT GTCCAAAACA AGTGCTTGAT  TGTAATGCGT GCACTTTCAT CAACAATCTT ATCTGCGATT TACTCATTTC TCTCTGCACA CCGTTGTCGC AGTGTGGGTG CTCCACAAGT TTAGATTTCA GGAAATATCA AATATCTTCA  AATTTCGGCA ATTAAACTCA ATAGCCATCT TTCCCGGTTG TGTTATTTTA CAGCATTGTT ATAATTTGTA CAGTTCAGGG TGCGGGTTTT CGTCATCTCG AAATTTGAGC ACTACCGACA  GCATCCGGGA GCTGCTGTGA GCAGAGAAGC TATTGAATGG AGAGCAGACA TAATTTGCTC CAGAGAAGAC CCACTTTATG GACTGCGGTA GTCCTGGTGA TATTGCAGCT GGCCCTTAGT  TGCTGGATGT GCACTGTGGA TGCGTTGCAA ACGGGATACT ACGCAGCGAC ATGTCCAAAT GCTGAAGCAA TCATAAGAGC GGCTATGGAG AGGGGGATGC AAGAGGATTC TGGTACTGCA  CCGGGTGTGC TACGGCTCCA CTTCCACGAT TGTTTTGTAG ATGGATGTGA CGGATCAGTC CTCCTCGACG GGCCGAGATC GGAGAAAACA GCATCGCCCA ACTTGACTTT GCGAGGATAC  GAGGTGATTG ACGCAGCTAA GGCAGACCTG GAGTTAGCAT GTTCGGGAAT CGTTTCATGC GCGGATATTC TTGCGTATGC TGCTCGTGAC GCTGTAGTAT TGACGGGAGG ATTAGGGTGG 
GCAGTCGAAG CCGGCAGATT AGACGGTCGC GTTTCCGACG CC 

Retrieve as FASTA