Entry information : MtPrx10 (Medtr2g029800.1[4.0] / Medtr2g029800.2[3.5])
Entry ID 337
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2010-09-14 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx10 (Medtr2g029800.1[4.0] / Medtr2g029800.2[3.5])
Name (synonym) MtPrx10 (Medtr2g029800.1[4.0] / Medtr2g029800.2[3.5])
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Root tips
Roots
Inducers Glucose treatment
Sinorhizobium inoculation
Repressor Glomus intraradices infection
Best BLASTp hits
Perox score E-value MtPrx10
start..stop
S start..stop
PsPrx29 624 0 1..353 1..350
MtPrx11 618 0 1..353 1..355
MsPrx02 617 0 1..353 1..355
PsPrx09 592 0 19..353 17..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11135619..11135840 222 N° 2 11136950..11137141 192 N° 3 11137230..11137395 166 N° 4 11137491..11137972 482
join(11135619..11135840,11136950..11137141,11137230..11137395,11137491..11137972 )


exon

Literature and cross-references MtPrx10 (Medtr2g029800.1[4.0] / Medtr2g029800.2[3.5])
Literature Journet,E.P. et al., unpublished, Torres-Jerez,I. et al., unpublished.
DNA ref. Phytozome 12:   chr2 (11135619..11137972)
Cluster/Prediction ref. Phytozome Gene 12:   31062558
Omic ref. Gene atlas:   Mtr.10370.1.S1_at Legoo:   Mtr.10370.1.S1_at
Protein sequence: MtPrx10 (Medtr2g029800.1[4.0] / Medtr2g029800.2[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (326)
PWM (Da):   %s   37919.18 (35223.8)  
PI (pH):   %s   7.64 (7.99) Peptide Signal:   %s   cut: 28 range:28-353
Sequence 394
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSFGLTLTALCCVVVVLGGLPFSSDAQLDPSFYRDTCPKVHSIIREVIRNVSKTDPRMLASLVRLHFHDCFVLGCDASVLLNKTDTIVSEQEAFPNINSLRGLDVVNQIKTAVEKACPNTVSCADILALSAQISSILADGPNWKVPLGRRDGLTANQSLANQNLPAPFNSLDQLKSAFAAQGLSTTDLVALSGAHTFGRARCTFITDRLYNFSSTGKPDPTLNTTYLQELRKICPNGGPPNNLANFDPTTPDKFDKNYYSNLQGKKGLLQSDQELFSTSGADTISIVNKFSADKNAFFDSFEAAMIKMGNIGVLTGKKGEIRKHCNFVNSKSVELGLVNVASTDSSGMVSSI

Retrieve as FASTA  
Remarks Complete sequence from 85 ESTs and genomic (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCCTTTGGTCTCACGTTGACTGCTCTATGCTGTGTAGTGGTTGTTCTTGGAGGGTTACCCTTCTCCTCAGATGCACAACTTGATCCTTCCTTCTATAGGGACACTTGTCCAAAGG
TTCATTCCATTATTCGTGAAGTCATAAGGAACGTCTCTAAGACTGATCCTCGCATGCTTGCTAGTCTCGTCAGACTTCACTTTCATGACTGTTTTGTTCTG
GTATATACTCTCTCCATAT
TCATTCTTTCCCATGTCTTTTGTGTCTACTCATACTCATGTATGTAGAACTAGCACCGACATGTCAAACTAAACATGTTTTGATATTCGTCACTAATACTAAACATTTATACATATAATT
ATTTATAATATTTAAGTTTTTCAAATTGTTACTAATATAAACGTGTAGTGTTAGGTCTGATGTCCATGTTAATATTTGTGTTGGATATTTTACTCGTGTAGAATCACTCATAGTTCTTTA
CTTGAATTGCTTCTATTTGATATATCTAATATTGTTAGTTTTAGTTTTATATTGAATTTAACTTAATCTAAAATATTGATTTGGGCTAAAGGTTATAAGAGTAAGAGATTTGAAATTTAA
ATTCAGACAAAAGAGAAAAAAAATGATATTCATCTAACTACTATTATAATTATTGTCCATTTCGTTGAGCTTGGTAACACAAACTTGTGACTTTAGTTGGGGTATAAAAGGCACGGATCC
TCTTCTGTGAGGAATTAATTGGAGGACATCCAGTGCTAAATCTTACCGTTCATTTTTTTAAAACAATTTAAATTGAATAATTTAAACAAAAAGTGAGTGGAGGAGATTCCATTGGATGAC
ACTTTTACGGGAGACAATCCCCACCCGGGTAATAAGATGTTGAAAGAGGTCTTTTGACGTGTGCCAAAATAAAATATTGTCCATTTCGGGAAAAAATTCTACAAAATACGTTTAGAGTTT
GTTCTATTGGTCACGTATATTGTCCAAAATAAAATATTGTCCATTTTGGAAAAAAACGCTATACCAAATACAAGATACATGACCAATAGAACAACAATGATACAAAAGTACAATCCAAAG
TCACACTTGCACTTCCACAACATGTTTGCATAATGGATCCACTTTTACACTCAACCGTTGAAATTGGAGAGTTACCTAAAGGGGTAAATATGATTTACTCATGGTCACTACTACAGTGGA
TACATGTCATTATGACATCATTTTGGTTTCTTTTCCATATTATTTTGAAGTTCTAACAACAATTTTTTTATTACTAGTAAATAAATTTTGATTTTTAATATTTGTATTATGTTGTCTATG
ATTGTAACAGGGTTGTGATGCATCAGTTTTATTGAACAAAACTGATACCATTGTGAGTGAACAAGAAGCTTTCCCAAATATCAACTCTCTACGAGGTTTGGATGTTGTGAATCAAATCAA
AACAGCAGTGGAAAAGGCTTGTCCTAACACAGTTTCTTGTGCTGATATTCTTGCCCTTTCTGCACAAATTTCCTCAATTTTG
GTATGCCTCATCCTAACATGATTAATAACAACTATCAT
TTTAATTATTAGTGATGATTAATTAAATTAATACATGTATGTATTGACAGGCAGATGGTCCTAATTGGAAGGTTCCCTTAGGAAGAAGGGATGGTTTAACCGCCAACCAATCGCTCGCTA
ATCAAAATCTTCCGGCTCCATTCAATTCGTTGGATCAACTTAAATCTGCATTTGCTGCTCAAGGCCTCAGTACTACTGATCTAGTTGCTCTCTCAG
GTATGCAATGTTTTCTAATTAAAA
GTGCTCGAATCACTTCGTTATCATGTATATAATAACAAATTATAAGGCTAATATATATGCTTCAAATGTAGGTGCTCATACATTCGGAAGAGCACGTTGCACTTTCATCACTGATCGATT
ATACAACTTCAGCAGTACAGGAAAACCTGATCCAACTCTTAATACAACTTATTTACAAGAATTACGTAAAATATGTCCTAATGGTGGACCACCAAATAACCTCGCCAATTTTGACCCAAC
GACTCCTGATAAATTTGACAAGAACTACTACTCCAATCTTCAGGGTAAAAAGGGTTTGCTTCAGAGTGACCAAGAGCTTTTCTCGACATCTGGTGCTGATACCATTAGCATTGTCAACAA
GTTCAGTGCTGACAAAAATGCTTTCTTTGATAGCTTTGAAGCCGCCATGATTAAAATGGGTAATATTGGTGTGCTGACCGGGAAAAAAGGAGAGATTAGAAAACATTGCAATTTTGTTAA
TTCAAAATCAGTTGAACTTGGTCTAGTGAATGTGGCTTCCACAGATTCATCGGGTATGGTTAGCTCAATTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCCTTTGGTCTCACGTTGACTGCTCTATGCTGTGTAGTGGTTGTTCTTGGAGGGTTACCCTTCTCCTCAGATGCACAACTTGATCCTTCCTTCTATAGGGACACTTGTCCAAAGG
TTCATTCCATTATTCGTGAAGTCATAAGGAACGTCTCTAAGACTGATCCTCGCATGCTTGCTAGTCTCGTCAGACTTCACTTTCATGACTGTTTTGTTCTG
GGTTGTGATGCATCAGTTT
TATTGAACAAAACTGATACCATTGTGAGTGAACAAGAAGCTTTCCCAAATATCAACTCTCTACGAGGTTTGGATGTTGTGAATCAAATCAAAACAGCAGTGGAAAAGGCTTGTCCTAACA
CAGTTTCTTGTGCTGATATTCTTGCCCTTTCTGCACAAATTTCCTCAATTTTG
GCAGATGGTCCTAATTGGAAGGTTCCCTTAGGAAGAAGGGATGGTTTAACCGCCAACCAATCGCTCG
CTAATCAAAATCTTCCGGCTCCATTCAATTCGTTGGATCAACTTAAATCTGCATTTGCTGCTCAAGGCCTCAGTACTACTGATCTAGTTGCTCTCTCAG
GTGCTCATACATTCGGAAGAG
CACGTTGCACTTTCATCACTGATCGATTATACAACTTCAGCAGTACAGGAAAACCTGATCCAACTCTTAATACAACTTATTTACAAGAATTACGTAAAATATGTCCTAATGGTGGACCAC
CAAATAACCTCGCCAATTTTGACCCAACGACTCCTGATAAATTTGACAAGAACTACTACTCCAATCTTCAGGGTAAAAAGGGTTTGCTTCAGAGTGACCAAGAGCTTTTCTCGACATCTG
GTGCTGATACCATTAGCATTGTCAACAAGTTCAGTGCTGACAAAAATGCTTTCTTTGATAGCTTTGAAGCCGCCATGATTAAAATGGGTAATATTGGTGTGCTGACCGGGAAAAAAGGAG
AGATTAGAAAACATTGCAATTTTGTTAATTCAAAATCAGTTGAACTTGGTCTAGTGAATGTGGCTTCCACAGATTCATCGGGTATGGTTAGCTCAATTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGATACTCAT AACAACAAAA TGAACTCCTT TGGTCTCACG TTGACTGCTC TATGCTGTGT AGTGGTTGTT CTTGGAGGGT TACCCTTCTC CTCAGATGCA CAACTTGATC CTTCCTTCTA  TAGGGACACT TGTCCAAAGG TTCATTCCAT TATTCGTGAA GTCATAAGGA ACGTCTCTAA GACTGATCCT CGCATGCTTG CTAGTCTCGT CAGACTTCAC TTTCATGACT GTTTTGTTCT  GGGTTGTGAT GCATCAGTTT TATTGAACAA AACTGATACC ATTGTGAGTG AACAAGAAGC TTTCCCAAAT ATCAACTCTC TACGAGGTTT GGATGTTGTG AATCAAATCA AAACAGCAGT  GGAAAAGGCT TGTCCTAACA CAGTTTCTTG TGCTGATATT CTTGCCCTTT CTGCACAAAT TTCCTCAATT TTGGCAGATG GTCCTAATTG GAAGGTTCCC TTAGGAAGAA GGGATGGTTT  AACCGCCAAC CAATCGCTCG CTAATCAAAA TCTTCCGGCT CCATTCAATT CGTTGGATCA ACTTAAATCT GCATTTGCTG CTCAAGGCCT CAGTACTACT GATCTAGTTG CTCTCTCAGG  TGCTCATACA TTCGGAAGAG CACGTTGCAC TTTCATCACT GATCGATTAT ACAACTTCAG CAGTACAGGA AAACCTGATC CAACTCTTAA TACAACTTAT TTACAAGAAT TACGTAAAAT  ATGTCCTAAT GGTGGACCAC CAAATAACCT CGCCAATTTT GACCCAACGA CTCCTGATAA ATTTGACAAG AACTACTACT CCAATCTTCA GGGTAAAAAG GGTTTGCTTC AGAGTGACCA  AGAGCTTTTC TCGACATCTG GTGCTGATAC CATTAGCATT GTCAACAAGT TCAGTGCTGA CAAAAATGCT TTCTTTGATA GCTTTGAAGC CGCCATGATT AAAATGGGTA ATATTGGTGT  GCTGACCGGG AAAAAAGGAG AGATTAGAAA ACATTGCAAT TTTGTTAATT CAAAATCAGT TGAACTTGGT CTAGTGAATG TGGCTTCCAC AGATTCATCG GGTATGGTTA GCTCAATTTA  AGTACTTTAG GGTCACTAGT TTCAAATGTA GTGATTGGAG ACCATAAATA AAGATGTTAT GACTAGGCAC ATTTGTGACT TGTGTCACAT AGTTACTAGG TGCTTTGTGA GGGAAGACTT 
TTTGTATTTG AAGTATTTCT TTGGGTTGTG TTCATAATCA AATTTTCTCT ATCTTATTTT GGACTTGTTT TGGCG 

Retrieve as FASTA