Entry information : MtPrx11 (Medtr2g029820.1 [4.0] / Medtr2g029820.1[3.5] / AC234842_17.1 [3.0])
Entry ID 338
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2010-09-14 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx11 (Medtr2g029820.1 [4.0] / Medtr2g029820.1[3.5] / AC234842_17.1 [3.0])
Name (synonym) MtPrx11 (Medtr2g029820.1 [4.0] / Medtr2g029820.1[3.5] / AC234842_17.1 [3.0])
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Roots
Inducers Drought
Pathogen interaction
Phosphate starvation
Repressor Glomus intraradices infection
Best BLASTp hits
Perox score E-value MtPrx11
start..stop
S start..stop
MsPrx02 716 0 1..355 1..355
MtPrx12 645 0 1..355 1..352
PsPrx09 623 0 19..355 17..353
MtPrx10 618 0 1..355 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11148216..11148437 222 N° 2 11149183..11149374 192 N° 3 11149480..11149645 166 N° 4 11149765..11150252 488
join(11148216..11148437,11149183..11149374,11149480..11149645,11149765..11150252 )


exon

Literature and cross-references MtPrx11 (Medtr2g029820.1 [4.0] / Medtr2g029820.1[3.5] / AC234842_17.1 [3.0])
Literature REFERENCE 1. Torres-Jerez,I. et al., unpublished,
REFERENCE 2. Liu,J., Scott,A.D., Harris,A.R., Gonzales,R.A., Bell,C.J., Flores, H.R., Inman,J.T., Weller,J.W., May,G.D. and Harrison,M.J. Expressed Sequence Tags from the Samuel Roberts Noble Foundation. Medicago truncatula phosphate-starved leaf library. Unpublished (2000)
DNA ref. Phytozome 12:   chr2 (11148216..11150252)
Cluster/Prediction ref. Phytozome Gene 12:   31065265
Omic ref. Gene atlas:   Mtr.40125.1.S1_at Legoo:   MtPrx11
Protein sequence: MtPrx11 (Medtr2g029820.1 [4.0] / Medtr2g029820.1[3.5] / AC234842_17.1 [3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (336)
PWM (Da):   %s   38066.2 (36140.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   7.62 (7.31) Peptide Signal:   %s   cut: 28 range:20-355
Sequence 396
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLRAVAIALCCIVVVLGGLPFSSNAQLDPSFYRNTCPNVSSIVREVIRSVSKKDPRMLGSLVRLHFHDCFVQGCDASVLLNKTDTVVSEQDAFPNRNSLRGLDVVNQIKTAVEKACPNTVSCADILALSAELSSTLADGPDWKVPLGRRDGLTANQLLANKNLPAPFNTTDQLKAAFAAQGLDTTDLVALSGAHTFGRAHCSLFVSRLYNFNGTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGSDTISIVNKFATDQKAFFESFKAAMIKMGNIGVLTGKQGEIRKQCNFVNSKSVELGLVNVASTDSSDEGMVSSM

Retrieve as FASTA  
Remarks Complete sequence from 37 ESTs and genomic sequence (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCCCTTCGTGCTGTAGCAATAGCTTTGTGCTGTATTGTGGTTGTGCTTGGAGGGTTACCCTTCTCTTCAAATGCACAACTTGATCCATCCTTTTACAGGAACACTTGTCCAAATG
TTAGTTCCATTGTTCGTGAAGTCATAAGAAGTGTTTCTAAGAAAGATCCTCGTATGCTTGGTAGTCTTGTCAGGCTTCACTTTCATGACTGTTTTGTTCAA
GTATGTATAATATTCAATC
ATTCACTAACTACATGTTCTATTTTGCTCATTGCGTATGACATGCTATAAATTCTTGAAATCTTAGTATACCTATAATCCTATAGTAGTATGATCTTCCCATTTAAGTAGAATTAGTACA
TAGTAAGATATAATATAAACTAGAACAAGATCAAATATAGCAAATAAAGAATATGTTTAGCATGTCCTTATGCTGCCCCTATATGTTATACAATCCAAAAATGAAAAAAAAAAAAAAAAT
CTTAATTTTGTGTCTTAAACATAACTTGTGTTTAAGGGCACAAATTAACATTCACTCTGCTCATTAAGAAAATATTAAGTAATATATCTAGCAAATGAATTGAGTTGGAATAGTGACTTT
ACTTACTTACCCGGCTGAACCAAATTCTAAAAATTTGAGGGTTGAAATAAATGAAAAATAGAATACTATTAGATATATTTACCCTTTTGTTTTATTATTAAAATATAATCATTCATTAGT
ATGTCCAATAATTATAGTTTAAAGTGTATGTCTAATAATTATAGTTTAAGGTTTTTTTCCTTTTTAGTGAGAGATTTTTTTTTTTACTCATTTAGAAGCAATGGAGCAAGTTTTTTTTTT
CAATTAGCAAAGACATTGTATAAAAAACTATGGCATCAACCTTTTAAATTGTACGGTTGAAGTTAATTTTTATTATGCTATTGTTATAATCATAATGTAAATTATGTGATCTATATACTG
TAACAGGGTTGTGATGCATCAGTTTTACTGAACAAAACTGATACCGTTGTGAGTGAACAAGATGCTTTTCCAAACAGAAACTCATTAAGAGGTTTAGATGTTGTGAATCAAATCAAAACA
GCTGTGGAAAAGGCTTGTCCTAACACAGTTTCTTGCGCTGATATTCTTGCCCTTTCTGCTGAATTATCATCTACACTG
GTATATATATGCCTCAAACTGTACTATATATTTTTCTCATTT
ACCATTGAATTTTCAAATCCAATTATTAATTCTGCTTATTTGTTTTGTGATGAAATAAAATAGGCAGATGGTCCTGACTGGAAAGTTCCTTTAGGAAGAAGAGATGGTTTAACAGCAAAC
CAATTACTTGCTAATAAAAATCTTCCAGCTCCTTTCAATACTACTGATCAACTTAAAGCTGCATTTGCTGCTCAAGGTCTCGATACTACTGATCTGGTTGCACTCTCGG
GTATGTAACAT
TTTTAAAGTTTTTGTTTAAAAAAATCTAATTGGTCGTTACAATGATGACGCCAATGTTACAATAATAATATATTTGATTATTGATTTATATATGTTTCTCGATTTCAGGTGCTCATACAT
TTGGAAGAGCTCATTGCTCTTTATTTGTTAGCCGATTGTACAACTTCAACGGTACAGGAAGTCCGGATCCAACTCTTAACACAACTTACTTACAACAATTGCGCACAATATGTCCCAATG
GTGGACCTGGCACGAACCTTACCAATTTCGATCCAACGACTCCTGATAAATTTGACAAGAACTATTACTCTAATCTTCAAGTGAAAAAGGGTTTGCTCCAAAGTGATCAAGAGTTGTTCT
CAACATCTGGTTCAGATACCATTAGCATTGTCAACAAATTTGCAACCGATCAAAAAGCTTTTTTTGAGAGCTTTAAGGCTGCTATGATCAAAATGGGAAATATTGGTGTGTTAACTGGGA
AACAAGGAGAGATTAGAAAACAATGCAACTTTGTTAATTCAAAATCAGTAGAACTAGGTTTAGTCAATGTGGCTTCCACAGATTCATCAGATGAGGGTATGGTTAGCTCAATGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCCCTTCGTGCTGTAGCAATAGCTTTGTGCTGTATTGTGGTTGTGCTTGGAGGGTTACCCTTCTCTTCAAATGCACAACTTGATCCATCCTTTTACAGGAACACTTGTCCAAATG
TTAGTTCCATTGTTCGTGAAGTCATAAGAAGTGTTTCTAAGAAAGATCCTCGTATGCTTGGTAGTCTTGTCAGGCTTCACTTTCATGACTGTTTTGTTCAA
GGTTGTGATGCATCAGTTT
TACTGAACAAAACTGATACCGTTGTGAGTGAACAAGATGCTTTTCCAAACAGAAACTCATTAAGAGGTTTAGATGTTGTGAATCAAATCAAAACAGCTGTGGAAAAGGCTTGTCCTAACA
CAGTTTCTTGCGCTGATATTCTTGCCCTTTCTGCTGAATTATCATCTACACTG
GCAGATGGTCCTGACTGGAAAGTTCCTTTAGGAAGAAGAGATGGTTTAACAGCAAACCAATTACTTG
CTAATAAAAATCTTCCAGCTCCTTTCAATACTACTGATCAACTTAAAGCTGCATTTGCTGCTCAAGGTCTCGATACTACTGATCTGGTTGCACTCTCGG
GTGCTCATACATTTGGAAGAG
CTCATTGCTCTTTATTTGTTAGCCGATTGTACAACTTCAACGGTACAGGAAGTCCGGATCCAACTCTTAACACAACTTACTTACAACAATTGCGCACAATATGTCCCAATGGTGGACCTG
GCACGAACCTTACCAATTTCGATCCAACGACTCCTGATAAATTTGACAAGAACTATTACTCTAATCTTCAAGTGAAAAAGGGTTTGCTCCAAAGTGATCAAGAGTTGTTCTCAACATCTG
GTTCAGATACCATTAGCATTGTCAACAAATTTGCAACCGATCAAAAAGCTTTTTTTGAGAGCTTTAAGGCTGCTATGATCAAAATGGGAAATATTGGTGTGTTAACTGGGAAACAAGGAG
AGATTAGAAAACAATGCAACTTTGTTAATTCAAAATCAGTAGAACTAGGTTTAGTCAATGTGGCTTCCACAGATTCATCAGATGAGGGTATGGTTAGCTCAATGTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GATCACTTTC ACTTTCACTT TCACAACAAA CAATGAACTC CCTTCGTGCT GTAGCAATAG CTTTGTGCTG TATTGTGGTT GTGCTTGGAG GGTTACCCTT CTCTTCAAAT GCACAACTTG  ATCCATCCTT TTACAGGAAC ACTTGTCCAA ATGTTAGTTC CATTGTTCGT GAAGTCATAA GAAGTGTTTC TAAGAAAGAT CCTCGTATGC TTGGTAGTCT TGTCAGGCTT CACTTTCATG  ACTGTTTTGT TCAAGGTTGT GATGCATCAG TTTTACTGAA CAAAACTGAT ACCGTTGTGA GTGAACAAGA TGCTTTTCCA AACAGAAACT CATTAAGAGG TTTAGATGTT GTGAATCAAA  TCAAAACAGC TGTGGAAAAG GCTTGTCCTA ACACAGTTTC TTGCGCTGAT ATTCTTGCCC TTTCTGCTGA ATTATCATCT ACACTGGCAG ATGGTCCTGA CTGGAAAGTT CCTTTAGGAA  GAAGAGATGG TTTAACAGCA AACCAATTAC TTGCTAATAA AAATCTTCCA GCTCCTTTCA ATACTACTGA TCAACTTAAA GCTGCATTTG CTGCTCAAGG TCTCGATACT ACTGATCTGG  TTGCACTCTC GGGTGCTCAT ACATTTGGAA GAGCTCATTG CTCTTTATTT GTTAGCCGAT TGTACAACTT CAACGGTACA GGAAGTCCGG ATCCAACTCT TAACACAACT TACTTACAAC  AATTGCGCAC AATATGTCCC AATGGTGGAC CTGGCACGAA CCTTACCAAT TTCGATCCAA CGACTCCTGA TAAATTTGAC AAGAACTATT ACTCTAATCT TCAAGTGAAA AAGGGTTTGC  TCCAAAGTGA TCAAGAGTTG TTCTCAACAT CTGGTTCAGA TACCATTAGC ATTGTCAACA AATTTGCAAC CGATCAAAAA GCTTTTTTTG AGAGCTTTAA GGCTGCTATG ATCAAAATGG  GAAATATTGG TGTGTTAACT GGGAAACAAG GAGAGATTAG AAAACAATGC AACTTTGTTA ATTCAAAATC AGTAGAACTA GGTTTAGTCA ATGTGGCTTC CACAGATTCA TCAGATGAGG  GTATGGTTAG CTCAATGTAA TTGTAGTGAT TGGAAGCAAC TAATAAATTA ATAAGCTATA ACTAGGCACA TTCATGGTAT GTGTGAGATA GTTGTTAGAT GCTTTGTGAG CTAAAATCGT 
TTGTATTTCA TTTGAAGTGT TTCTTTGAGT TGTGAGTTGA TAATGATCAT TTTCTGTTTC TT 

Retrieve as FASTA