Entry information : CsAPx02 (orange1.1g025588m)
Entry ID 3422
Creation 2006-07-28 (Felipe Teixeira)
Last sequence changes 2011-07-01 (Qiang Li)
Sequence status complete
Reviewer Qiang Li
Last annotation changes 2012-01-04 (Qiang LI)
Peroxidase information: CsAPx02 (orange1.1g025588m)
Name (synonym) CsAPx02 (orange1.1g025588m)
Class Ascorbate peroxidase    [Orthogroup: APx2001]
Taxonomy Eukaryota Viridiplantae Streptophyta Rutaceae Citrus
Organism Citrus sinensis    [TaxId: 2711 ]
Cellular localisation Cytosolic
Tissue types Fruits
Whole plant
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsAPx02
start..stop
S start..stop
CclAPx05 511 0 1..251 1..251
PtriAPx02 506 0 1..250 1..250
CroAPx02 491 2.05e-179 1..251 1..251
PtAPx02 478 4.43e-174 1..249 1..249
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3422' 'join(23610..23728,23871..24045,24163..24228,24757..24805,24909..24991,25127..25206,25330..25432,25526..25584,25692..25710)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 23610..23728 117 N° 2 23871..24045 173 N° 3 24163..24228 64 N° 4 24757..24805 47
N° 5 24909..24991 81 N° 6 25127..25206 78 N° 7 25330..25432 101 N° 8 25526..25584 57
N° 9 25692..25710 17  
join(23610..23728,23871..24045,24163..24228,24757..24805,24909..24991,25127..252 06,25330..25432,25526..25584,25692..25710)


exon

Literature and cross-references CsAPx02 (orange1.1g025588m)
Literature Uratsu,S., Baek,J., Leslie,A., Xu,J., Cook,D. and Dandekar,A. Analysis of peel specific genes in Citrus (2004). Unpublished (2004)
DNA ref. Phytozome 12:   scaffold00115 (23610..25710)
Cluster/Prediction ref. UniGene:   Csi.4283
Protein sequence: CsAPx02 (orange1.1g025588m)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   27555.97  
PI (pH):   %s   5.57
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGKCYPKVSDEYQKAVEKCKRKLRGLIAEKHCAPIILRLAWHSAGTYDVNTKTGGPFGTIRHPDELAHEANNGLDIAVRLLEPIEQQFPILSYADFYQLAGVVAVEVTGGPEIPFHPGRP
DKSDPPPEGRLPNATKGSDHLRDVFGHMGLSDKEIVVLSGGHTLGRCHKERSGFEGPWTNNPLIFDNSYFKELLSGEKEGLLQLPSDKALLEDPVFRPLVEKYAADEDAVFADYAEAHLK
LSELGFADAE*

Retrieve as FASTA  
Remarks Complete sequence from genome and 14 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGTGTTATCCAAAAGTGAGCGATGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGACTCATTGCTGAGAAACACTGTGCCCCTATCATTCTTCGCTTGGCG
CGTAAGTTTATCTTTAACCTTTCTTAATTAAGATCACTTTCAGTGACCACCGTTGATGCGTTATTAATCTGCATGATGATGAGTATTGGATCAAAATCAAGATGTGTATATATATGTAAG
TTTTTTGGGTTGCACATATGCAGATGGCACTCAGCGGGGACTTATGACGTGAACACGAAGACAGGAGGGCCTTTTGGGACGATCAGGCACCCAGATGAGCTTGCTCATGAGGCTAACAAT
GGTCTTGATATTGCTGTCAGGCTTTTGGAGCCCATCGAGCAGCAGTTTCCTATCTTGTCCTACGCTGATTTCTATCAG
AGGTAATTATTATTTATATCCAACTGTTGACTACAGAAAATG
ATTTGCTTTATGATCACTTTCTATGGATTACTTTGGATTGGTGAATTGACCATGGTTTGTGTTTTATTTTGTTGAAGTTGGCTGGAGTTGTTGCCGTTGAAGTTACCGGAGGGCCTGAAA
TACCTTTCCACCCTGGAAGACCG
CGGTGAGGGCTTTTTATTTTTTATTTTATTTCTTTTTTCATATGCATGTTCTCTAGCTCCCGAAAAAGACATTATACAGACTGGATTAAAATAAAAT
TTTGTTGATCAGCATCTTGGACTAGGCATCACTTAGAAGGTTTTGTTAGAAGATCATCAATGCATAATTAAATAGACGTGAGTCACTTGCTGGGAACTCAGGGCCTTTACTTGACGTGTG
TGATGTGTATGTCATTCCTATTATGCATAATTTCTATTTATGTTACTGTCACTAGTGTACAATTATATTGATGTGTATTCATGTGTTTGATTTACAATTAAATGAATGAAAAGAATAATA
ATAACAATAAACTAAGGCATCCTCATTCTGTCGTCCATTTGGATTGTATTGAAGCAACAGAGAAAGCAACTAATCTATCCAAATAATACAGCTTGTTGATAGCTAAGCAATTTTAGAAGG
CAGCAGCGAAGATTGAACTATTGATGCTGAACTGGTATTCTTTATATTAAGTTCTAAACATCTGGTGTTGCAGGACAAATCTGATCCGCCCCCAGAAGGTCGCTTGCCAAATGCCACCAA
AG
AGGTCAGTTTCAGATAATTTGCTCAGGTTTAAATCATTGTAAAATCAGTACAGTGTATCTTCCCACAAATTAAGTCACTTACTCCTTTTGTTATCATCACTGCAGGTTCTGACCATCT
GAGAGATGTCTTCGGCCACATGGGTCTGAGTGATAAGGAAATCGTTGTTTTATCCGGCGGTCATACATTG
TGGTCTGTGAGCTAACATTACAATAGTTCTATATTCTTCCATGGACTGCT
GCTTGTTTTTGGAAGCACGATGCAATTTAACATCTTTAGCTTGTTGTACTGACTTGTAATGTTGGTCTCATGGGAATCCTTGTACAGGGTAGGTGCCACAAGGAGCGTTCTGGATTTGAA
GGACCCTGGACTAACAATCCACTTATTTTTGACAATTCATATTTTAA
AAGTAATAAGCACATTTATCATTCTTCGTACTTTCACAAGTTCTTTTTATATGGGGCCTCATTCAAATTTACG
TGTCTCAGAGCAACAGACTGATGTGAATTATTTCATTATTTTAATTTGATAGGGAATTGCTGAGTGGAGAGAAAGAAGGTCTACTTCAGCTGCCATCAGACAAGGCTCTTCTCGAGGACC
CAGTGTTTCGTCCTCTTGTTGAAAAATATGCTGCA
CAGTAAGTACCTGGCCATATTTTTATATTGATTTTATTTATGGAATTGGTCGCAATGTCTACGAAACTTACTGTGTTGTGGTGAC
ATTGCTTCAGGATGAGGATGCCGTCTTTGCAGATTACGCTGAAGCTCATTTGAAGCTCTCAGAACTCGGGGGTTAGTCTTCTATGACTTCTCTTCACCTATTACCTAGTCCTTTAATCAT
TTAATCATGCGTGCTTCTACTTGAGTATTGACTTGTGAATTTCTATTTCCTCCTCCAGATTTGCGGATGCTGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGAAAGTGTTATCCAAAAGTGAGCGATGAGTATCAGAAAGCAGTGGAGAAATGCAAGAGGAAACTCAGAGGACTCATTGCTGAGAAACACTGTGCCCCTATCATTCTTCGCTTGGCA
TGGCACTCAGCGGGGACTTATGACGTGAACACGAAGACAGGAGGGCCTTTTGGGACGATCAGGCACCCAGATGAGCTTGCTCATGAGGCTAACAATGGTCTTGATATTGCTGTCAGGCTT
TTGGAGCCCATCGAGCAGCAGTTTCCTATCTTGTCCTACGCTGATTTCTATCAG
TTGGCTGGAGTTGTTGCCGTTGAAGTTACCGGAGGGCCTGAAATACCTTTCCACCCTGGAAGACCG
GACAAATCTGATCCGCCCCCAGAAGGTCGCTTGCCAAATGCCACCAAAGGTTCTGACCATCTGAGAGATGTCTTCGGCCACATGGGTCTGAGTGATAAGGAAATCGTTGTTTTATCCGGC
GGTCATACATTG
GGTAGGTGCCACAAGGAGCGTTCTGGATTTGAAGGACCCTGGACTAACAATCCACTTATTTTTGACAATTCATATTTTAAGGAATTGCTGAGTGGAGAGAAAGAAGGT
CTACTTCAGCTGCCATCAGACAAGGCTCTTCTCGAGGACCCAGTGTTTCGTCCTCTTGTTGAAAAATATGCTGCA
GATGAGGATGCCGTCTTTGCAGATTACGCTGAAGCTCATTTGAAG
CTCTCAGAACTCGG
ATTTGCGGATGCTGAGTAA

Retrieve as FASTA