Entry information : MtPrx16 (Medtr2g029750.1 [4.0] / Medtr2g029750.1 [3.5])
Entry ID 343
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2010-09-14 (Haythem Mhadhbi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx16 (Medtr2g029750.1 [4.0] / Medtr2g029750.1 [3.5])
Name (synonym) MtPrx16 (Medtr2g029750.1 [4.0] / Medtr2g029750.1 [3.5])
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Roots
Inducers Aphanomyces euteiches zoospores infection
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Glomus versiforme infection
Meloidogyne incognita
Mycorrhiza
Nodulation
Pathogen interaction
Phytophthora infection
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx16
start..stop
S start..stop
MtPrx17 622 0 1..354 1..355
MtPrx71 559 0 1..354 1..355
PsPrx13 549 0 1..354 1..357
MtPrx10 536 0 1..354 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11117725..11117946 222 N° 2 11118102..11118293 192 N° 3 11118402..11118567 166 N° 4 11118952..11119436 485
join(11117725..11117946,11118102..11118293,11118402..11118567,11118952..11119436 )


exon

Literature and cross-references MtPrx16 (Medtr2g029750.1 [4.0] / Medtr2g029750.1 [3.5])
Literature Torres-Jerez,I. et al., unpublished
DNA ref. Phytozome 12:   chr2 (11117725..11119436)
Cluster/Prediction ref. Phytozome Gene 12:   31065879 UniGene:   Mtr.15555
Omic ref. Gene atlas:   Mtr.10356.1.S1_at Legoo:   Mtr.10356.1.S1_at
Protein sequence: MtPrx16 (Medtr2g029750.1 [4.0] / Medtr2g029750.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   354 (327)
PWM (Da):   %s   38170.29 (35475.9) Transmb domain:   %s   i2-24o
PI (pH):   %s   7.6 (7.68) Peptide Signal:   %s   cut: 28 range:28-354
Sequence 395
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLSLIATALCCVVVVFGGLPFSSNAQLSPDFYAKTCPQLQSIVFQILEKVSKTDSRMPASIIRLHFHDCFVQGCDASVLLNKTSTIASEQDAGPNINSLRRLDVINQIKTEVEKVCPNKVSCADILTLAAGVSSVLSGGPGWIVPLGRRDSLTANQSLANRNLPGPSSSLDQLKSSFAAQGLNTVDLVALSGAHTLGRARCLFILDRLYDFDNTGKPDPTLDPTYLKQLQKQCPQNGPGNNVVNFDPTTPDKFDKNYYNNLQGKKGLLQSDQELFSTPGADTISIVNNFGNNQNVFFQNFINSMIKMGNIGVLTGKKGEIRKQCNFVNKKSSELDLASVTSESMEGDMVSSI

Retrieve as FASTA  
Remarks Complete sequence from 73 ESTs and genomic sequence (chromo 2, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAATTCCCTTAGTCTCATAGCAACAGCTCTATGCTGTGTAGTTGTTGTGTTTGGAGGACTACCCTTCTCTTCAAATGCACAGCTTAGTCCAGACTTTTACGCCAAAACATGTCCCCAAT
TGCAATCTATTGTGTTTCAAATCTTAGAGAAGGTTTCTAAGACTGATTCTCGAATGCCTGCGAGTATCATTAGGCTTCACTTTCATGATTGTTTCGTTCAA
GTATGTATACCTATTATTA
TTCAGTCTTAGAAACCAAGTTATTGTTTTTCACTTTGTGTTTATGATAATGAAAAATAATCAGTAGTTCATAGAGTTAACATTTTCTCCTTAATTTAAGCAAAATGACTTAATATGACGA
TTTATGATTGAATCAGGGTTGTGATGCATCAGTTTTGTTGAATAAAACTTCTACTATTGCGAGTGAACAAGATGCTGGTCCAAATATAAACTCCTTAAGAAGATTGGATGTTATCAATCA
GATTAAAACTGAGGTGGAAAAAGTTTGTCCTAATAAAGTTTCTTGTGCTGATATTCTCACACTTGCAGCTGGAGTATCTTCAGTTCTG
GTAAATATGTTAAAACCCAATTATGTTTTAGT
AATTTTACATAATATCATAATAACATAATAATGGTTGAATCAACTTCTTTTATTTATTTATTTATTGTATTCACAGAGTGGGGGTCCAGGTTGGATCGTTCCATTGGGAAGAAGGGATAG
TCTAACAGCAAATCAATCCCTTGCCAATAGAAATCTTCCAGGTCCCAGCTCCAGTCTAGATCAACTTAAATCTTCCTTTGCTGCTCAAGGACTCAACACGGTTGATCTAGTAGCACTCTC
AG
GTATGCAAATACATGCACCATTTCCTAAATAATAATAATAATATAATTTTCTATCAAACCATGATATTTAGATAAGATGATATGAGCCTCCTTAATTTTAAATTTGAATTTAATCATG
TACCATAGTGATATTAAAATTTATCGCGACTTTAGATTTCACATGACTCGGATAAAAAAAAAAAAAAAAAAGGACAAACTGCATCCATTAACACTCAAATAAGTATTTTTAAAAGTAATT
AAATCTTGATGAGGAATTGTTTGAACTAGGATTCAAACTCGAATTCTTCCAAAAAAAATGTGTATCTTACTAGATCTTATTAATCCCTAGAGCTATATAGCACATGATGTAGGAGTATAT
GATTTACTTGAATGGTTCAATTTCAGGTGCCCATACATTAGGAAGAGCACGTTGTCTTTTCATACTTGATCGATTATACGACTTCGACAATACTGGCAAACCTGATCCAACTCTTGACCC
AACATACTTAAAACAGTTGCAAAAACAATGTCCTCAAAATGGACCTGGAAATAACGTTGTCAATTTTGATCCAACAACTCCCGATAAATTCGACAAGAACTACTACAACAATCTTCAAGG
TAAAAAGGGTTTGCTTCAAAGTGACCAAGAATTGTTCTCAACACCGGGTGCAGATACCATTAGCATTGTCAACAACTTTGGAAACAACCAAAATGTTTTCTTCCAGAACTTTATAAATTC
AATGATTAAAATGGGTAATATTGGCGTGCTTACTGGAAAGAAAGGAGAAATTAGAAAGCAGTGCAATTTTGTTAACAAGAAATCTTCTGAATTGGATCTTGCTAGTGTGACCTCAGAATC
AATGGAGGGGGATATGGTTAGTTCAATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAATTCCCTTAGTCTCATAGCAACAGCTCTATGCTGTGTAGTTGTTGTGTTTGGAGGACTACCCTTCTCTTCAAATGCACAGCTTAGTCCAGACTTTTACGCCAAAACATGTCCCCAAT
TGCAATCTATTGTGTTTCAAATCTTAGAGAAGGTTTCTAAGACTGATTCTCGAATGCCTGCGAGTATCATTAGGCTTCACTTTCATGATTGTTTCGTTCAA
GGTTGTGATGCATCAGTTT
TGTTGAATAAAACTTCTACTATTGCGAGTGAACAAGATGCTGGTCCAAATATAAACTCCTTAAGAAGATTGGATGTTATCAATCAGATTAAAACTGAGGTGGAAAAAGTTTGTCCTAATA
AAGTTTCTTGTGCTGATATTCTCACACTTGCAGCTGGAGTATCTTCAGTTCTG
AGTGGGGGTCCAGGTTGGATCGTTCCATTGGGAAGAAGGGATAGTCTAACAGCAAATCAATCCCTTG
CCAATAGAAATCTTCCAGGTCCCAGCTCCAGTCTAGATCAACTTAAATCTTCCTTTGCTGCTCAAGGACTCAACACGGTTGATCTAGTAGCACTCTCAG
GTGCCCATACATTAGGAAGAG
CACGTTGTCTTTTCATACTTGATCGATTATACGACTTCGACAATACTGGCAAACCTGATCCAACTCTTGACCCAACATACTTAAAACAGTTGCAAAAACAATGTCCTCAAAATGGACCTG
GAAATAACGTTGTCAATTTTGATCCAACAACTCCCGATAAATTCGACAAGAACTACTACAACAATCTTCAAGGTAAAAAGGGTTTGCTTCAAAGTGACCAAGAATTGTTCTCAACACCGG
GTGCAGATACCATTAGCATTGTCAACAACTTTGGAAACAACCAAAATGTTTTCTTCCAGAACTTTATAAATTCAATGATTAAAATGGGTAATATTGGCGTGCTTACTGGAAAGAAAGGAG
AAATTAGAAAGCAGTGCAATTTTGTTAACAAGAAATCTTCTGAATTGGATCTTGCTAGTGTGACCTCAGAATCAATGGAGGGGGATATGGTTAGTTCAATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATTATGGCCG GGGACATCAA CTTCAAACAC ATAGCTCTAA AAATGAATTC CCTTAGTCTC ATAGCAACAG CTCTATGCTG TGTAGTTGTT GTGTTTGGAG GACTACCCTT CTCTTCAAAT  GCACAGCTTA GTCCAGACTT TTACGCCAAA ACATGTCCCC AATTGCAATC TATTGTGTTT CAAATCTTAG AGAAGGTTTC TAAGACTGAT TCTCGAATGC CTGCGAGTAT CATTAGGCTT  CACTTTCATG ATTGTTTCGT TCAAGGTTGT GATGCATCAG TTTTGTTGAA TAAAACTTCT ACTATTGCGA GTGAACAAGA TGCTGGTCCA AATATAAACT CCTTAAGAAG ATTGGATGTT  ATCAATCAGA TTAAAACTGA GGTGGAAAAA GTTTGTCCTA ATAAAGTTTC TTGTGCTGAT ATTCTCACAC TTGCAGCTGG AGTATCTTCA GTTCTGAGTG GGGGTCCAGG TTGGATCGTT  CCATTGGGAA GAAGGGATAG TCTAACAGCA AATCAATCCC TTGCCAATAG AAATCTTCCA GGTCCCAGCT CCAGTCTAGA TCAACTTAAA TCTTCCTTTG CTGCTCAAGG ACTCAACACG  GTTGATCTAG TAGCACTCTC AGGTGCCCAT ACATTAGGAA GAGCACGTTG TCTTTTCATA CTTGATCGAT TATACGACTT CGACAATACT GGCAAACCTG ATCCAACTCT TGACCCAACA  TACTTAAAAC AGTTGCAAAA ACAATGTCCT CAAAATGGAC CTGGAAATAA CGTTGTCAAT TTTGATCCAA CAACTCCCGA TAAATTCGAC AAGAACTACT ACAACAATCT TCAAGGTAAA  AAGGGTTTGC TTCAAAGTGA CCAAGAATTG TTCTCAACAC CGGGTGCAGA TACCATTAGC ATTGTCAACA ACTTTGGAAA CAACCAAAAT GTTTTCTTCC AGAACTTTAT AAATTCAATG  ATTAAAATGG GTAATATTGG CGTGCTTACT GGAAAGAAAG GAGAAATTAG AAAGCAGTGC AATTTTGTTA ACAAGAAATC TTCTGAATTG GATCTTGCTA GTGTGACCTC AGAATCAATG  GAGGGGGATA TGGTTAGTTC AATCTAAATG AATGTGGGTT ACTTTAGTTG AAATGCATGT GGTGATTGGA ATTCACTAAT AAAGAAAAGT GCTAGCTAGG CACATCTGTG CCTTGATGTG 
TATGTTATGT GCTTTATGTG TGCAAGATAA TCTTTTTTTT TTCTAAGTAA TTTTCATTAT ATTATAGTAT ATCCTCTCTT TCCGTCAC 

Retrieve as FASTA