1. Browse the Database
  2. View Redoxidase
Entry information : MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Entry ID 344
Creation 2006-01-17 (Christophe Dunand)
Last sequence changes 2010-09-15 (Haythem Mhadhbi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Name (synonym) MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducers Cyst nematode infection
Glomus intraradices infection
Nitrogen starvation
Nitrogen treatment
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx17
start..stop		 S start..stop
MtPrx16 622 0 1..355 1..354
MtPrx71 577 0 1..355 1..355
PsPrx13 556 0 1..355 1..357
MtPrx10 546 0 1..355 1..353
Gene structure Fichier Exons►


exon

Literature and cross-references MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Literature Harrison,M.J. et al., unpublished
DNA ref. Phytozome 12:   chr2 (11109261..11111668)
Cluster/Prediction ref. Phytozome Gene 12:   31065335
Omic ref. Gene atlas:   Mtr.40091.1.S1_at Legoo:   Mtr.40091.1.S1_at
Protein sequence: MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (328)
PWM (Da):   %s   38575.55 (35764.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.41 (8.39) Peptide Signal:   %s   cut: 28 range:28-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSFRVIVTALCCVVVVFGGLPFSSNAQLDPYFYGKTCPKLHSIA
FKVLRKVAKTDPRMPASIIRLHFHDCFVQGCDASVLLNNTATIVSEQDAFPNINSLRGLDVINQIKTKVEKACPNRVSCADILTLASGISSVLTGGPGWEVPLGRRDSLTANQSLANQNLPGPNFSLDRLKSAFAAQGLNTVDLVALSG
AHTFGRARCLFILDRLYNFNNTGKPDPTLDTTYLQQLRNQCPQNGTGNNRVNFDPTTPDTLDKNFYNNLQGKKGLLQSDQELFSTPGADTISIVNSFANSQNVFFQNFINSMIKMGNIDV
LTGKKGEIRKQCNFINKKSSELDLGIVASAESMEGDMVSSI

Retrieve as FASTA  
Remarks Complete sequence from 33 ESTs and genomic (chromo 2, 3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST