Entry information : MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Entry ID 344
Creation 2006-01-17 (Christophe Dunand)
Last sequence changes 2010-09-15 (Haythem Mhadhbi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Name (synonym) MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Class Class III peroxidase    [Orthogroup: Prx043]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type N/D
Inducers Cyst nematode infection
Glomus intraradices infection
Nitrogen starvation
Nitrogen treatment
Pathogen interaction
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx17
start..stop
S start..stop
MtPrx16 622 0 1..355 1..354
MtPrx71 577 0 1..355 1..355
PsPrx13 556 0 1..355 1..357
MtPrx10 546 0 1..355 1..353
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11109261..11109482 222 N° 2 11110098..11110289 192 N° 3 11110452..11110617 166 N° 4 11111181..11111668 488
join(11109261..11109482,11110098..11110289,11110452..11110617,11111181..11111668 )


exon

Literature and cross-references MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Literature Harrison,M.J. et al., unpublished
DNA ref. Phytozome 12:   chr2 (11109261..11111668)
Cluster/Prediction ref. Phytozome Gene 12:   31065335
Omic ref. Gene atlas:   Mtr.40091.1.S1_at Legoo:   Mtr.40091.1.S1_at
Protein sequence: MtPrx17 (Medtr2g029740.1 [4.0] / Medtr2g029740.1 [3.5] / AC234842_24.1)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (328)
PWM (Da):   %s   38575.55 (35764.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.41 (8.39) Peptide Signal:   %s   cut: 28 range:28-355
Sequence 396
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSFRVIVTALCCVVVVFGGLPFSSNAQLDPYFYGKTCPKLHSIAFKVLRKVAKTDPRMPASIIRLHFHDCFVQGCDASVLLNNTATIVSEQDAFPNINSLRGLDVINQIKTKVEKACPNRVSCADILTLASGISSVLTGGPGWEVPLGRRDSLTANQSLANQNLPGPNFSLDRLKSAFAAQGLNTVDLVALSGAHTFGRARCLFILDRLYNFNNTGKPDPTLDTTYLQQLRNQCPQNGTGNNRVNFDPTTPDTLDKNFYNNLQGKKGLLQSDQELFSTPGADTISIVNSFANSQNVFFQNFINSMIKMGNIDVLTGKKGEIRKQCNFINKKSSELDLGIVASAESMEGDMVSSI

Retrieve as FASTA  
Remarks Complete sequence from 33 ESTs and genomic (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCATTTCGTGTCATTGTAACAGCTTTGTGCTGTGTAGTGGTTGTGTTTGGAGGACTACCCTTCTCTTCAAATGCACAACTTGATCCATACTTTTATGGCAAAACTTGTCCCAAAT
TGCATTCTATAGCATTTAAAGTCTTGCGGAAAGTTGCTAAGACGGATCCCCGAATGCCTGCCAGTATCATCAGGCTTCATTTTCATGATTGTTTCGTTCAA
GTATGTTTCTATTATTATG
CTTTGCTGTAGTATTTATCATTCACCCCCCAGTTATATATTTGTTAGCATGTGTTGAAAAATACTTTAGGGTTCCACATCTGAAAAATCAAGACAATTAAAAGTGCATACATAACCATAA
AAGGAGTTGACTGAATTCGATTTATGGGCAATACATTTCTTATGCATGTACTTCCTTATTATTATTTTTTGGCTCTAAAAAAATAACACTAACCAACAATATATGTAGGGTTGGTCTAAA
GGTAAGACTACTAAAACCTTTGTCTAGGCCCTTTCTTGTTAATTTAATAATTGTCATATTTGCCAAAGATTAATAGTGTCATTACTAGTTAATTTTCAACATAATTTTAATGGATTTATT
TATTTATTTTACTATCTAACTAATAATATTCTCAAGTTATTATTTTATGATAATTAAAATTAGTCAATAGTTTATAAAGTTAATTTAATAAAAAAATTATTCTCTTTCTTTTACTTATAA
TACCTTCTCTCTAATTTATGGGACATAATATGACAATTTTTTATTATCATATATGTATATATGTAGTTTTTGAGATAGAGCACTAAATAACTTGATATTATTTATGATTGAAACAGGGTT
GTGATGCATCAGTTTTGTTGAATAACACCGCAACTATTGTGAGTGAACAAGATGCTTTTCCAAATATCAACTCCTTAAGAGGATTGGATGTTATCAATCAAATCAAGACTAAAGTGGAAA
AAGCTTGCCCTAATAGAGTTTCTTGTGCTGATATTCTTACACTTGCGTCTGGAATATCTTCTGTTCTG
GTACATATTTTTAGTTTCAAGTATTTTCCTATACAACTATACTTTTTCTTTT
TTTGGTAGAATACATATATACATTTTATTTTAATTAGTTAAAATATTATTACTTCTTTAATTTTATTCATTGTATGATCTTAAAATAATACAATCAATCTATTTACACAGACTGGGGGTC
CAGGTTGGGAGGTTCCACTAGGAAGAAGGGATAGTCTAACAGCAAATCAATCCCTTGCCAATCAAAATCTTCCAGGTCCCAACTTCAGTCTAGATCGACTTAAATCTGCCTTTGCTGCTC
AAGGACTTAACACGGTTGACCTAGTAGCACTCTCAG
GTATATATATACATGCACCATTTTCTAAATGTTATCTATAATGATAACAATATAATTTTTTATCCAACAGTGATATTTAGATAA
TATTACCATGAATTTTTTATCATAACAAAGATTTCGAATTTGGATATGATCAATGAACCATATTATTATTAAAACTTCAAATTGTTGAGGAGAGTTGTCAACGCTTTAGACTTGATGAAT
AGTCTATGGAGGTGTGGGTTACTCAATTATAAAAAATAAAAAAAATTAGAAAATTAATTTTAAAATCAGTTGACTTTTGAATAACTTGACCATTAAAAAAAGATAAATGTCATACATCAA
GATCATTGCCTAATAAGTCGACGAGGACAAAAAAAAAATCTCCTTAACTGTAAATTCATAGGGAAATGCTCTAGAAGTGACCGAAAGATAAGTAAATTTTAGTTAAGAATTGTTTGATTT
ATGATTCGAACTTGTATTTTTTTTAGAAAAATTTCGTGATTACAAACACTTTCTCGTAAAACAGTTATGTTGCCACGTCTTTAAATATGATCTCCTTAACTAAACTACTTCAACTTCAGG
TGCTCATACATTTGGGAGAGCACGTTGCCTTTTCATCCTTGATCGATTATACAACTTCAACAATACTGGCAAACCCGATCCAACTCTTGATACAACATACTTACAACAGTTGCGAAACCA
ATGCCCTCAGAATGGAACTGGAAATAACCGTGTTAATTTCGACCCAACGACTCCTGATACATTGGACAAGAACTTCTACAACAATCTTCAAGGTAAAAAGGGTTTGCTTCAAAGTGACCA
AGAATTATTCTCAACACCGGGTGCAGATACCATTAGCATTGTCAACAGCTTTGCAAATAGCCAAAATGTTTTCTTTCAGAACTTTATAAATTCAATGATTAAAATGGGTAATATTGATGT
GCTTACCGGAAAGAAAGGAGAAATTAGAAAACAATGCAATTTTATTAACAAGAAATCTTCTGAATTGGATCTTGGCATTGTGGCCTCTGCAGAATCAATGGAAGGGGATATGGTTAGTTC
AATCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGAACTCATTTCGTGTCATTGTAACAGCTTTGTGCTGTGTAGTGGTTGTGTTTGGAGGACTACCCTTCTCTTCAAATGCACAACTTGATCCATACTTTTATGGCAAAACTTGTCCCAAAT
TGCATTCTATAGCATTTAAAGTCTTGCGGAAAGTTGCTAAGACGGATCCCCGAATGCCTGCCAGTATCATCAGGCTTCATTTTCATGATTGTTTCGTTCAA
GGTTGTGATGCATCAGTTT
TGTTGAATAACACCGCAACTATTGTGAGTGAACAAGATGCTTTTCCAAATATCAACTCCTTAAGAGGATTGGATGTTATCAATCAAATCAAGACTAAAGTGGAAAAAGCTTGCCCTAATA
GAGTTTCTTGTGCTGATATTCTTACACTTGCGTCTGGAATATCTTCTGTTCTG
ACTGGGGGTCCAGGTTGGGAGGTTCCACTAGGAAGAAGGGATAGTCTAACAGCAAATCAATCCCTTG
CCAATCAAAATCTTCCAGGTCCCAACTTCAGTCTAGATCGACTTAAATCTGCCTTTGCTGCTCAAGGACTTAACACGGTTGACCTAGTAGCACTCTCAG
GTGCTCATACATTTGGGAGAG
CACGTTGCCTTTTCATCCTTGATCGATTATACAACTTCAACAATACTGGCAAACCCGATCCAACTCTTGATACAACATACTTACAACAGTTGCGAAACCAATGCCCTCAGAATGGAACTG
GAAATAACCGTGTTAATTTCGACCCAACGACTCCTGATACATTGGACAAGAACTTCTACAACAATCTTCAAGGTAAAAAGGGTTTGCTTCAAAGTGACCAAGAATTATTCTCAACACCGG
GTGCAGATACCATTAGCATTGTCAACAGCTTTGCAAATAGCCAAAATGTTTTCTTTCAGAACTTTATAAATTCAATGATTAAAATGGGTAATATTGATGTGCTTACCGGAAAGAAAGGAG
AAATTAGAAAACAATGCAATTTTATTAACAAGAAATCTTCTGAATTGGATCTTGGCATTGTGGCCTCTGCAGAATCAATGGAAGGGGATATGGTTAGTTCAATCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACAGAAAC TTCAAACACA ATTCTAATAT CATTTAGGGG TAACAATGAA CTCATTTCGT GTCATTGTAA CAGCTTTGTG CTGTGTAGTG GTTGTGTTTG GAGGACTACC CTTCTCTTCA  AATGCACAAC TTGATCCATA CTTTTATGGC AAAACTTGTC CCAAATTGCA TTCTATAGCA TTTAAAGTCT TGCGGAAAGT TGCTAAGACG GATCCCCGAA TGCCTGCCAG TATCATCAGG  CTTCATTTTC ATGATTGTTT CGTTCAAGGT TGTGATGCAT CAGTTTTGTT GAATAACACC GCAACTATTG TGAGTGAACA AGATGCTTTT CCAAATATCA ACTCCTTAAG AGGATTGGAT  GTTATCAATC AAATCAAGAC TAAAGTGGAA AAAGCTTGCC CTAATAGAGT TTCTTGTGCT GATATTCTTA CACTTGCGTC TGGAATATCT TCTGTTCTGA CTGGGGGTCC AGGTTGGGAG  GTTCCACTAG GAAGAAGGGA TAGTCTAACA GCAAATCAAT CCCTTGCCAA TCAAAATCTT CCAGGTCCCA ACTTCAGTCT AGATCGACTT AAATCTGCCT TTGCTGCTCA AGGACTTAAC  ACGGTTGACC TAGTAGCACT CTCAGGTGCT CATACATTTG GGAGAGCACG TTGCCTTTTC ATCCTTGATC GATTATACAA CTTCAACAAT ACTGGCAAAC CCGATCCAAC TCTTGATACA  ACATACTTAC AACAGTTGCG AAACCAATGC CCTCAGAATG GAACTGGAAA TAACCGTGTT AATTTCGACC CAACGACTCC TGATACATTG GACAAGAACT TCTACAACAA TCTTCAAGGT  AAAAAGGGTT TGCTTCAAAG TGACCAAGAA TTATTCTCAA CACCGGGTGC AGATACCATT AGCATTGTCA ACAGCTTTGC AAATAGCCAA AATGTTTTCT TTCAGAACTT TATAAATTCA  ATGATTAAAA TGGGTAATAT TGATGTGCTT ACCGGAAAGA AAGGAGAAAT TAGAAAACAA TGCAATTTTA TTAACAAGAA ATCTTCTGAA TTGGATCTTG GCATTGTGGC CTCTGCAGAA  TCAATGGAAG GGGATATGGT TAGTTCAATC TAAATGAATG TGGGTTACTT TAGATGAAAT GTGGTGATTG GAATTCACTA ATAAAGAGAA GTGCTGGCTA AGCACATTTG TGTCATGAGG 
TATACTGTAT TTTACGTGTT TTATGTGTGT AAGATAACCT TCTTTCAATG TAATTTTCAT TATAAAATCC TTTC 

Retrieve as FASTA