1. Browse the Database
  2. View Redoxidase
Entry information : MtPrx20 (Medtr2g029830.1 [4.0] / Medtr2g029830.1 [3.5])
Entry ID 346
Creation 2009-01-02 (Christophe Dunand)
Last sequence changes 2011-07-13 (Qiang Li)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx20 (Medtr2g029830.1 [4.0] / Medtr2g029830.1 [3.5])
Name (synonym) MtPrx20 (Medtr2g029830.1 [4.0] / Medtr2g029830.1 [3.5])
Class Class III peroxidase    [Orthogroup: Prx048]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Leaves
Inducers Colletotrichum inoculation
Drought
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Methyl jasmonate treatment
Pathogen interaction
Virus infection
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx20
start..stop		 S start..stop
MsPrx03 702 0 1..355 1..358
MsPrx14 653 0 8..355 1..347
MsPrx02 589 0 1..353 1..353
MtPrx11 583 0 1..354 1..355
Gene structure Fichier Exons►


exon

Literature and cross-references MtPrx20 (Medtr2g029830.1 [4.0] / Medtr2g029830.1 [3.5])
Literature Korth,K. et al., unpublished, Torres-Jerez,I. et al., unpublished.
DNA ref. Phytozome 12:   chr2 (11154682..11156923)
Cluster/Prediction ref. Phytozome Gene 12:   31066768 UniGene:   Mtr.13229
Omic ref. Gene atlas:   Mtr.40121.1.S1_at Legoo:   Mtr.40121.1.S1_at
Protein sequence: MtPrx20 (Medtr2g029830.1 [4.0] / Medtr2g029830.1 [3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   355 (329)
PWM (Da):   %s   37742.01 (35050.7) Transmb domain:   %s   i13-30o
PI (pH):   %s   6.49 (6.88) Peptide Signal:   %s   cut: 27 range:27-355
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSLATSMWCVVLLVVLGGLPFSSDAQLSPTFYSKTCPTVSSIVS
NVLTNVSKTDQRMLASLVRLHFHDCFVLGCDASVLLNNTATIVSEQQAFPNNNSLRGLDVVNQIKTAIESACPNTVSCADILALAAQASSVLAQGPSWTVPLGRRDGLTANRTLANQNLPAPFNTLVQLKAAFTAQGLNTTDLVALSG
AHTFGRAHCAQFVGRLYNFSSTGSPDPTLNTTYLQQLRTICPNGGPGTNLTNFDPTTPDKFDKNYYSNLQVKKGLLQSDQELFSTSGADTISIVNKFSTDQNAFFESFKAAMIKMGNIGV
LTGTKGEIRKQCNFVNSNSAELDLATIASIVESLEDGIASVI

Retrieve as FASTA  
Remarks Complete sequence from 23 ESTs and genomic (chromo 2, 3 introns).
DNA ►
Send to BLAST
CDS►
Send to BLAST