Entry information : MtPrx29 (Medtr5g074970.1[4.0] / Medtr5g074970.1[3.5] / Medtr5g082850.1[3.0])
Entry ID 354
Creation 2006-01-30 (Christophe Dunand)
Last sequence changes 2010-09-16 (Haythem Mhadhbi)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx29 (Medtr5g074970.1[4.0] / Medtr5g074970.1[3.5] / Medtr5g082850.1[3.0])
Name (synonym) MtPrx29 (Medtr5g074970.1[4.0] / Medtr5g074970.1[3.5] / Medtr5g082850.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx190]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Flowers
Germinating seeds
Leaves
Mycorrhizal roots
Seedling roots
Seedlings
Shoots
Inducers Colletotrichum inoculation
Drought
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Methyl jasmonate treatment
Nitrogen starvation
Pathogen interaction
Phosphate starvation
UV irradiation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx29
start..stop
S start..stop
PvPrx03 476 6e-171 1..326 1..324
GmPrx121 472 2e-169 23..326 23..324
GmPrx50 471 8e-169 23..326 23..324
QsPrx02 466 5e-167 1..326 1..329
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 31854213..31854437 225 N° 2 31855931..31856122 192 N° 3 31856694..31856862 169 N° 4 31857523..31857917 395
join(31854213..31854437,31855931..31856122,31856694..31856862,31857523..31857917 )


exon

Literature and cross-references MtPrx29 (Medtr5g074970.1[4.0] / Medtr5g074970.1[3.5] / Medtr5g082850.1[3.0])
Literature Liu,J. et al., unpublished
DNA ref. Phytozome 12:   chr5 (31854213..31857917)
Cluster/Prediction ref. Phytozome Gene 12:   31085970 UniGene:   Mtr.5534
Omic ref. Gene atlas:   Mtr.31.1.S1_at   Mtr.32367.1.S1_s_at Legoo:   Mtr.32367.1.S1_s_at
Protein sequence: MtPrx29 (Medtr5g074970.1[4.0] / Medtr5g074970.1[3.5] / Medtr5g082850.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (298)
PWM (Da):   %s   35658.14 (32526.6) Transmb domain:   %s   i9-28o
PI (pH):   %s   9.81 (9.92) Peptide Signal:   %s   cut: 29 range:29-326
Sequence 367
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSSSKVSLNLFCFVLFMFFLIDGSFSQLSENFYAKKCPNVFKAVNSVVHSAVAREPRMGGSLLRLHFHDCFVNGCDGSVLLDDTPSNKGEKTALPNKDSLRGFEVIDAIKSKVESVCPGVVSCADIVAIAARDSVVNLGGPFWKVKLGRRDSKTASLNDANSGVIPPPFSTLNNLINRFKAQGLSTKDMVALSGAHTIGKARCTVYRDRIYNDTNIDSLFAKSRQRNCPRKSGTIKDNNVAVLDFKTPNHFDNLYYKNLINKKGLLHSDQELFNGGSTDSLVKSYSNNQNAFESDFAIAMIKMGNNKPLTGSNGEIRKQCRRAN

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, 3 introns) and 63 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTCTTCTTCTAAAGTTTCACTAAACTTATTTTGCTTTGTTTTGTTCATGTTTTTTCTTATAGATGGTTCTTTTTCTCAACTATCTGAAAATTTCTATGCTAAGAAGTGTCCCA
ATGTTTTTAAGGCTGTAAACTCAGTTGTTCACTCTGCTGTTGCTAGAGAACCTCGTATGGGAGGATCTCTTCTTCGTCTCCATTTTCATGACTGCTTTGTCAAT
GTAAATTTATCTTCAA
ACTAAGTTCTTATATATGCTTTTCTTTAGTTATATATTGTTATAAACCATCATTGAGAGAAATTGGTATACCATTTAATGATGATGAAATTAGAGAGATATTTCATTTTTTTGTCACAAT
TTTTTTTTCCTATTATTATACACCATTTCTATATTATCCACCACTAAGAAAACTAGTGAGAAAAATTTTAGAGAAGGAAAACATGAACTTTTTCTTTAAATCCTTCACTAAATAGTGTGA
TGATAGTATTAGAAAGTGATTTCATTTCTTCCTCAATAAATTTTGATGCCAATTTATTTGTTCTAATAGTGATATATAATAAATATTTTTTTTTTGACAAATAATCAATATTATTATTTA
GTAACCAATTGTTCATATGAGGATTTCAAATGTGAAAAGAAAAATATTAATATAGATAATAGATTGAATATATTATTTTTTGGTAGTTTGATAATGAATTGAATATGATTAGTGAGTTGT
ATTGAGTGAATTGAATAGGGTCATATACACTTTTCATGTCGTTACGCTACTAGACTATTTATACTTTATTTTTATTCTGTACCTATCTCTTTCAAGGAGTCTTATTGAGTGACGTACCAA
TTACAATAATGGAACATTTCATGCATAATTAAAAAAGAATTAAAATGAACTGTCTATTGTTTGCATGATTATGCACCACTCATCTTTGAAAGCGATTTACCATGTCCCCAACATAGGTTG
GTGAATATATTTTAAATAAATTAGCCAAAAAATTACTAAATTTATGTCGGTTGAATGTGTATTTTACACAATTTCCTATTTGAATATGTACTAAATTATGCATGAATATGCACTTTTAAA
TTCTTGAGATAGGGTGTTTTTTTTTTTGGCAAGTACCCTTGTAATTTTTCAATCTTGTGAGTTAAATACTCTTTGTACTTATCTTTTTATCATTATCTAATAAATTTGGCTGTTCAAAAA
AAAATTCTTTTAAAAACATGAAAGTTTTTTTAGTAGTAATGGAAAACAACAGTACTTTTTTTTGAGGGGAAAACAACAGTACAAATTAGTCTTTTATTTCTTGTCAAAAAGATTAACTGT
TTATTTGCATCGCGAATAAGCATATTCCGAAGAAAAAAGTGAAAGATAAATTCCAAAAATGCCTTTTTGAAGCTTGATGTTTAAACTTGTTTAAACTGTAAATGTGCTAACAAATAATTT
ATGTTCATTTTGACGTTCTTTACTTTAAACATACACCTCATATTAATTAGACATGCGTTACTAACTTTTTTACAAATTTAAACGGTGTGCGTGTGACTTTACAAATTTACCACATTTGAC
ATGTCAGATAATTTAAATGTGGTTGACTACGTGCAATCACATGAATTTGAATTGTAAACAACTCAAATATTTATTTACCAATCGCCCTAAAACTTCATAAAGATAGGTTTTTGGTGAACT
TACTTATCATAAATCGCTTTTTACTTATTGAAAACAGGGTTGTGATGGATCAGTGCTACTTGATGACACACCCTCTAATAAAGGAGAGAAGACAGCACTTCCCAACAAAGATTCTTTGAG
AGGTTTTGAAGTAATTGATGCCATAAAGTCTAAGGTGGAGTCAGTATGCCCTGGTGTGGTCTCATGTGCTGATATTGTAGCCATTGCTGCTCGTGATTCTGTTGTAAAT
GTGAGTACAAA
ATCAATATGTTAAACACTGAAATTTTAGTAATTTTTCAATTATAAATTCACTACTAGAAGAACTTTAATAATCAACAAAAATTAGAGACACCAGAAAACAGCAAAAACTATAAAATATTT
AAATTCAGAGCAGCCTCGATGTGGGGAGAGACTGTAGACTAGGATGTTGTCGAATTTGATAGTTGCATAAATTATATTATCCAACAAGTTATATGCATATTAGTTTATTTTTATTGAAGA
GATTTTTAATGGAATAGTCATAGATACAAAAGTTATATCATATATATTTACAATAATAAAATATAGATCAAGTGTGACGTTTAAACAACCACGATACATATAACGATACATATAACTGTT
TAATAAATCTAACACTTATATATCATTCGACAAAAGACTTGTTCTCCAACTAAAAAAAAGGTATAATATAATTTATAAAAATTTAAAAACCCTAATTTCTTTTCTTCCAATAAATGCTTC
TATTTTCAAATCTTTTGACAAGTGTCTTATGCATAAGATATTAGTTTTTAAATTTATTTTTATTCTATCATATTTTGCAGCTTGGGGGGCCTTTTTGGAAAGTTAAACTTGGAAGAAGGG
ATTCAAAAACAGCCAGCCTCAATGATGCAAACAGTGGTGTAATTCCACCTCCCTTTTCTACCCTTAACAACCTTATCAATAGGTTTAAAGCTCAAGGACTCTCTACTAAGGACATGGTGG
CCTTATCTG
GTACATGTCTTTTTCCTATTGTTTCTAATTTAAACATTTTTTCTTCTAACTTCCATTATCATCACACAATTATTAGTTTTTATTTTGCCTCATTTGCTTGATATCACACAT
TTGTTTGACTAGGATGTGATGTTTAAACAACCACGTAGACTTTCATGTCATGCCTAATTTTCATTATGTTCTAAGTGACTTCTAATAAAAAAAAAAAAAAAAAGAACAATGAAACAAAAA
AACATGTTTATCCAACCAAGAAAATACATTAAATTATTGGTTATGTTTGAATAAAATGAAAATAGTAACACCGTTTAAATTTCATTTTCAAGACTTAGTAATCTGACTCTAGATTCTTGG
TATATACAAATTCAACTTACATAGCACTATTGATTAATAAATCCAAATATTATTTGAACATTTAGAAATTATTGAAGTGCCAAATTCAACTTACATAGCACTATTTATTTTTTTGTCTCA
ACCTTCGATATTAACAGAAAATGAATTCTGATGGTTTTGATAATCTAAAGATCGATTTGAATATAAATAAAATCTTATTAAGGATTATCTCAGATATAATTTAAATTTGGATTCTCTTGA
ACGATTCGTTACGAACTAAAACGCATTAATCACTTGAGTTTAACTATTTGTTTTCTTTATGCTTCTTAGGAGCTCACACAATTGGAAAGGCAAGGTGTACCGTTTATAGAGATCGTATTT
ACAATGATACAAATATTGATAGTTTATTTGCCAAGTCAAGGCAGAGGAATTGTCCAAGGAAAAGTGGTACAATAAAAGACAACAATGTAGCTGTCCTAGACTTCAAAACACCAAACCATT
TTGATAACTTATACTACAAGAATCTCATCAACAAAAAGGGACTCCTTCATTCTGATCAAGAGCTTTTCAATGGAGGGTCCACCGATTCATTGGTTAAATCTTATAGCAATAATCAAAATG
CATTTGAATCTGATTTTGCTATTGCAATGATTAAGATGGGAAATAACAAGCCTCTTACCGGATCAAATGGGGAGATTAGGAAGCAATGCAGGAGAGCCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCACTTTCTTCTTCTAAAGTTTCACTAAACTTATTTTGCTTTGTTTTGTTCATGTTTTTTCTTATAGATGGTTCTTTTTCTCAACTATCTGAAAATTTCTATGCTAAGAAGTGTCCCA
ATGTTTTTAAGGCTGTAAACTCAGTTGTTCACTCTGCTGTTGCTAGAGAACCTCGTATGGGAGGATCTCTTCTTCGTCTCCATTTTCATGACTGCTTTGTCAAT
GGTTGTGATGGATCAG
TGCTACTTGATGACACACCCTCTAATAAAGGAGAGAAGACAGCACTTCCCAACAAAGATTCTTTGAGAGGTTTTGAAGTAATTGATGCCATAAAGTCTAAGGTGGAGTCAGTATGCCCTG
GTGTGGTCTCATGTGCTGATATTGTAGCCATTGCTGCTCGTGATTCTGTTGTAAAT
CTTGGGGGGCCTTTTTGGAAAGTTAAACTTGGAAGAAGGGATTCAAAAACAGCCAGCCTCAATG
ATGCAAACAGTGGTGTAATTCCACCTCCCTTTTCTACCCTTAACAACCTTATCAATAGGTTTAAAGCTCAAGGACTCTCTACTAAGGACATGGTGGCCTTATCTG
GAGCTCACACAATTG
GAAAGGCAAGGTGTACCGTTTATAGAGATCGTATTTACAATGATACAAATATTGATAGTTTATTTGCCAAGTCAAGGCAGAGGAATTGTCCAAGGAAAAGTGGTACAATAAAAGACAACA
ATGTAGCTGTCCTAGACTTCAAAACACCAAACCATTTTGATAACTTATACTACAAGAATCTCATCAACAAAAAGGGACTCCTTCATTCTGATCAAGAGCTTTTCAATGGAGGGTCCACCG
ATTCATTGGTTAAATCTTATAGCAATAATCAAAATGCATTTGAATCTGATTTTGCTATTGCAATGATTAAGATGGGAAATAACAAGCCTCTTACCGGATCAAATGGGGAGATTAGGAAGC
AATGCAGGAGAGCCAATTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GCACCAGTAA TTATTTGTCT AAGTCTTTAG GATTAGGTGA GGGTAAGAGT TGCCATAATA TCTCTATATA TAATGTTCCA CACTTCTTAG ACTATATCCA TCCATCTTCT AAAGCCTTAT  ACTACTACTT AGCAAAATGG CACTTTCTTC TTCTAAAGTT TCACTAAACT TATTTTGCTT TGTTTTGTTC ATGTTTTTTC TTATAGATGG TTCTTTTTCT CAACTATCTG AAAATTTCTA  TGCTAAGAAG TGTCCCAATG TTTTTAAGGC TGTAAACTCA GTTGTTCACT CTGCTGTTGC TAGAGAACCT CGTATGGGAG GATCTCTTCT TCGTCTCCAT TTTCATGACT GCTTTGTCAA  TGGTTGTGAT GGATCAGTGC TACTTGATGA CACACCCTCT AATAAAGGAG AGAAGACAGC ACTTCCCAAC AAAGATTCTT TGAGAGGTTT TGAAGTAATT GATGCCATAA AGTCTAAGGT  GGAGTCAGTA TGCCCTGGTG TGGTCTCATG TGCTGATATT GTAGCCATTG CTGCTCGTGA TTCTGTTGTA AATCTTGGGG GGCCTTTTTG GAAAGTTAAA CTTGGAAGAA GGGATTCAAA  AACAGCCAGC CTCAATGATG CAAACAGTGG TGTAATTCCA CCTCCCTTTT CTACCCTTAA CAACCTTATC AATAGGTTTA AAGCTCAAGG ACTCTCTACT AAGGACATGG TGGCCTTATC  TGGAGCTCAC ACAATTGGAA AGGCAAGGTG TACCGTTTAT AGAGATCGTA TTTACAATGA TACAAATATT GATAGTTTAT TTGCCAAGTC AAGGCAGAGG AATTGTCCAA GGAAAAGTGG  TACAATAAAA GACAACAATG TAGCTGTCCT AGACTTCAAA ACACCAAACC ATTTTGATAA CTTATACTAC AAGAATCTCA TCAACAAAAA GGGACTCCTT CATTCTGATC AAGAGCTTTT  CAATGGAGGG TCCACCGATT CATTGGTTAA ATCTTATAGC AATAATCAAA ATGCATTTGA ATCTGATTTT GCTATTGCAA TGATTAAGAT GGGAAATAAC AAGCCTCTTA CCGGATCAAA  TGGGGAGATT AGGAAGCAAT GCAGGAGAGC CAATTAACGA AAATCTGGAT AGCACATATA CTTCAGATTG AAGGCATGTT TAATCTTTAG TGTTCAAATC TATGTGTCGG TATTAGTGTT  TCATAAAAGG AAACTTTTAA AACAAATCAA GTGTGTGTTT TTTTTCTTCT TCAAGTACAT ATACCCCAAA AGTGGTGGTA TTCTTTAGTT AATTTATATG TTCTATTGAT TTCTAGTGCC  TTATAAAATT ATATTGTTGC TTTTTAAATT TTACCCAAGT TAATGTAATT TAAATTGCAA AGCAGTGTTG TGACAAAAGT GTCACTTTAA GGACGTGTTT ATGTAGTAAT CACATGAATA 
AATATGAATG TATATTTCAA TATTGAAAAA AATGAATGAA TGAGTTTAAT TAATAT 

Retrieve as FASTA