Entry information : MtPrx30 (Medtr2g029730.1[4.0] / Medtr2g029730.1[3.5])
Entry ID 355
Creation 2006-01-18 (Christophe Dunand)
Last sequence changes 2013-12-31 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-29 (Christophe Dunand)
Peroxidase information: MtPrx30 (Medtr2g029730.1[4.0] / Medtr2g029730.1[3.5])
Name (synonym) MtPrx30 (Medtr2g029730.1[4.0] / Medtr2g029730.1[3.5])
Class Class III peroxidase    [Orthogroup: Prx188]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Roots
Seedlings
Inducers Aphanomyces euteiches infection
Pathogen interaction
Repressors Glomus intraradices infection
Glomus mosseae infection
Best BLASTp hits
Perox score E-value MtPrx30
start..stop
S start..stop
MtPrx111 592 0 1..345 1..344
GmPrx01 522 0 1..340 1..343
PvPrx01 469 3e-167 23..345 22..348
MsPrx02 462 9e-165 1..345 1..355
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11103288..11103497 210 N° 2 11104103..11104294 192 N° 3 11104394..11104559 166 N° 4 11104678..11105147 470
join(11103288..11103497,11104103..11104294,11104394..11104559,11104678..11105147 )


exon

Literature and cross-references MtPrx30 (Medtr2g029730.1[4.0] / Medtr2g029730.1[3.5])
Literature REFERENCE 1. Nyamsuren,O. et al., Physiol.Mol.Plant Pathol. 63(1),17-26(2003)
REFERENCE 2. Natalija Hohnjec, Martin F. Vieweg, Alfred Puhler, Anke Becker, and Helge Kuster. Overlaps in the Transcriptional Profiles of Medicago truncatula Roots Inoculated with Two Different Glomus Fungi Provide Insights into the Genetic Program Activated during Arbuscular Mycorrhiza. Plant Physiol. 137: 1283-1301(2005).
DNA ref. Phytozome 12:   chr2 (11103288..11105147)
EST ref. GenBank:   BF643750.1 [5' end]   CA922444.1 [3' end]
Cluster/Prediction ref. Phytozome Gene 12:   31063423 UniGene:   Mtr.10842
Omic ref. Gene atlas:   Mtr.43507.1.S1_at Legoo:   Mtr.43507.1.S1_at
Protein sequence: MtPrx30 (Medtr2g029730.1[4.0] / Medtr2g029730.1[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   345 (322)
PWM (Da):   %s   37305.77 (34845.5)  
PI (pH):   %s   6.61 (6.23) Peptide Signal:   %s   cut: 24 range:24-345
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGSMRIVLGVALWCAVLMHTGYAQLSPSFYSQTCPFLYPIVFRVIYEASHTDPRIGASLIRLHFHDCFVQGCDGSVLLNNTDTIVSEQDAFPNRNSLKRLDVVNKIKTAVEEECPNTVSCADILTIAAEVSSILGGGPSWPIPLGRRDSLTANITLANQNLPGPFSTLDQLKASFLVQGLNTTDLVTLSGAHTFGRARCSAFINRLYNFSGTGNPDPTLNTTYLQTLRLICPQNSTGNNLANLDLTTPNHFDNKYYSNLQNLNGLLHSDQVLLSTPNADTIAIVNSFSNNQSLFFLNFRVSMIKMANIGVLTGDEGEIRLQCNFVNGNSAGLARGGSKDGLLSSL

Retrieve as FASTA  
Remarks Complete sequece from 16 ESTs and genomic. (chromo 2, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATGCGTATTGTACTAGGGGTTGCACTTTGGTGTGCAGTCTTGATGCATACAGGATATGCTCAGCTTAGTCCCTCATTTTACAGCCAAACATGTCCATTTCTATACCCTATT
GTGTTTAGAGTCATCTATGAGGCTTCCCACACTGATCCACGTATTGGTGCCAGTCTCATCAGGCTTCATTTTCATGATTGCTTTGTTCAA
GTATGTTATTATCTATTGATTGTTATGTTC
ATCCATATAAATGCTCAGCCTATGTATATAAGATCAATATTTCTAACTTTTTTACTCTAGGGTTTTGCAATTACAACCGACTTTTTCTTTGAATTGAACACTATAATGTTAATTTTGAAC
TTTTTTTTACTATACTGATATGGTGTTGAAAAAGTTAGTAGCCAAAGTTCTTTACCAAAGAAGAAATATAGGTTCGATCTATTCCTTAATTCGTCTATGATAAAAGAAGCCTAATCATGT
TTGCAAGGAAAAAATGAATGCTCTTATGTCGTCTATAAGATTTTCAGTGGAATTCAATAATCAACTATACCGATACACTTCAAATAAAATAAAGATTTAAATATGATTTTAGTCAATGCA
TTATAGCATTTTTAACTCCCAACGTTAACTTATTGGATCCTAAGACATGATTTTAATTATTGGGCCACAGACTCTAAGAACAATTATAATATTCGTAAAGACTAAATTTAAATAAAAAAC
TATCACGTATTAAAATAAAAATATACTAGAAATGTAAGGAACAAAATCATATTTAACCCTAAAATAAAGTAAATGAAAAGTCTTTTTTGTGACAGGGCTGTGATGGATCAGTTTTGTTGA
ACAACACTGATACAATTGTGAGTGAACAAGATGCATTTCCAAACAGAAACTCATTAAAGCGTTTGGATGTTGTGAATAAAATCAAGACAGCAGTTGAAGAAGAATGTCCTAACACTGTTT
CTTGTGCTGATATTCTTACTATTGCAGCTGAAGTATCTTCTATTCTG
GTATGTTTTTAATTTCATAAACTTTATATGGTCACTAGTAATTTTTGCTTCTCAAATATCCATCTTAAAATCA
TCTAATATATATTGATCTATGAACAGGGAGGAGGTCCCTCATGGCCAATTCCATTGGGAAGAAGGGATAGCTTAACCGCCAACATAACTCTTGCAAATCAAAACCTTCCCGGACCCTTCT
CCACATTGGATCAACTTAAAGCTTCATTTCTTGTTCAAGGTCTCAACACTACAGATTTAGTTACACTCTCAG
GTATAAATCATAAAAAAAAAAAGTTTTATAGCTATTTAAACCTTTTCT
AGCATGCCGTTGTAATTAAACTCAGAGAAATATTACACACCATGTCATTAACCTAAATATTTTTTTATAGGTGCTCATACATTTGGAAGAGCTCGTTGCAGTGCATTCATCAACCGTCTA
TACAATTTCAGTGGCACTGGAAATCCTGATCCAACATTAAACACAACTTACTTACAAACATTGCGTCTGATATGTCCCCAAAATTCAACAGGAAACAACCTAGCCAATTTGGACCTTACC
ACACCTAATCACTTTGATAACAAATATTACTCCAATCTTCAAAACCTCAATGGCTTACTTCATAGTGATCAAGTTCTATTATCCACTCCTAATGCAGACACCATTGCTATTGTTAATAGC
TTTAGCAATAACCAATCTCTCTTCTTTCTGAATTTTAGGGTTTCGATGATTAAAATGGCGAATATTGGAGTGTTAACTGGTGATGAAGGGGAGATTAGGTTGCAATGTAATTTTGTAAAT
GGTAACTCCGCTGGATTAGCTCGTGGTGGATCAAAAGATGGCTTGTTAAGCTCACTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCATGCGTATTGTACTAGGGGTTGCACTTTGGTGTGCAGTCTTGATGCATACAGGATATGCTCAGCTTAGTCCCTCATTTTACAGCCAAACATGTCCATTTCTATACCCTATT
GTGTTTAGAGTCATCTATGAGGCTTCCCACACTGATCCACGTATTGGTGCCAGTCTCATCAGGCTTCATTTTCATGATTGCTTTGTTCAA
GGCTGTGATGGATCAGTTTTGTTGAACAAC
ACTGATACAATTGTGAGTGAACAAGATGCATTTCCAAACAGAAACTCATTAAAGCGTTTGGATGTTGTGAATAAAATCAAGACAGCAGTTGAAGAAGAATGTCCTAACACTGTTTCTTGT
GCTGATATTCTTACTATTGCAGCTGAAGTATCTTCTATTCTG
GGAGGAGGTCCCTCATGGCCAATTCCATTGGGAAGAAGGGATAGCTTAACCGCCAACATAACTCTTGCAAATCAAAAC
CTTCCCGGACCCTTCTCCACATTGGATCAACTTAAAGCTTCATTTCTTGTTCAAGGTCTCAACACTACAGATTTAGTTACACTCTCAG
GTGCTCATACATTTGGAAGAGCTCGTTGCAGT
GCATTCATCAACCGTCTATACAATTTCAGTGGCACTGGAAATCCTGATCCAACATTAAACACAACTTACTTACAAACATTGCGTCTGATATGTCCCCAAAATTCAACAGGAAACAACCTA
GCCAATTTGGACCTTACCACACCTAATCACTTTGATAACAAATATTACTCCAATCTTCAAAACCTCAATGGCTTACTTCATAGTGATCAAGTTCTATTATCCACTCCTAATGCAGACACC
ATTGCTATTGTTAATAGCTTTAGCAATAACCAATCTCTCTTCTTTCTGAATTTTAGGGTTTCGATGATTAAAATGGCGAATATTGGAGTGTTAACTGGTGATGAAGGGGAGATTAGGTTG
CAATGTAATTTTGTAAATGGTAACTCCGCTGGATTAGCTCGTGGTGGATCAAAAGATGGCTTGTTAAGCTCACTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTCCA TGCGTATTGT ACTAGGGGTT GCACTTTGGT GTGCAGTCTT GATGCATACA GGATATGCTC AGCTTAGTCC CTCATTTTAC AGCCAAACAT GTCCATTTCT ATACCCTATT  GTGTTTAGAG TCATCTATGA GGCTTCCCAC ACTGATCCAC GTATTGGTGC CAGTCTCATC AGGCTTCATT TTCATGATTG CTTTGTTCAA GGCTGTGATG GATCAGTTTT GTTGAACAAC  ACTGATACAA TTGTGAGTGA ACAAGATGCA TTTCCAAACA GAAACTCATT AAAGCGTTTG GATGTTGTGA ATAAAATCAA GACAGCAGTT GAAGAAGAAT GTCCTAACAC TGTTTCTTGT  GCTGATATTC TTACTATTGC AGCTGAAGTA TCTTCTATTC TGGGAGGAGG TCCCTCATGG CCAATTCCAT TGGGAAGAAG GGATAGCTTA ACCGCCAACA TAACTCTTGC AAATCAAAAC  CTTCCCGGAC CCTTCTCCAC ATTGGATCAA CTTAAAGCTT CATTTCTTGT TCAAGGTCTC AACACTACAG ATTTAGTTAC ACTCTCAGGT GCTCATACAT TTGGAAGAGC TCGTTGCAGT  GCATTCATCA ACCGTCTATA CAATTTCAGT GGCACTGGAA ATCCTGATCC AACATTAAAC ACAACTTACT TACAAACATT GCGTCTGATA TGTCCCCAAA ATTCAACAGG AAACAACCTA  GCCAATTTGG ACCTTACCAC ACCTAATCAC TTTGATAACA AATATTACTC CAATCTTCAA AACCTCAATG GCTTACTTCA TAGTGATCAA GTTCTATTAT CCACTCCTAA TGCAGACACC  ATTGCTATTG TTAATAGCTT TAGCAATAAC CAATCTCTCT TCTTTCTGAA TTTTAGGGTT TCGATGATTA AAATGGCGAA TATTGGAGTG TTAACTGGTG ATGAAGGGGA GATTAGGTTG  CAATGTAATT TTGTAAATGG TAACTCCGCT GGATTAGCTC GTGGTGGATC AAAAGATGGC TTGTTAAGCT CACTCTAAAT AAGTTAATTG ATATGTGATT GAAAGGGTAA ACATTGTAAG 
ATATATACTT AATTAGAATA AATAAAAAGT GTGCATGTCA ATATGATTTT GTCATGTACA TCTTATCAT 

Retrieve as FASTA