Entry information : AaePxt02
Entry ID 3555
Creation 2006-10-26 (Christophe Dunand)
Last sequence changes 2016-01-15 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: AaePxt02
Name AaePxt02
Class Invertebrate peroxinectin    [Orthogroup: Pxt001]
Taxonomy Eukaryota Metazoa Arthropoda Insecta Culicidae Aedes
Organism Aedes aegypti (Yellowfever mosquito)    [TaxId: 7159 ]
Cellular localisation N/D
Tissue type N/D
Inducer Blood sucking
Repressor N/D
Best BLASTp hits
Perox score E-value AaePxt02
start..stop
S start..stop
AaePxt01 879 0 1..787 1..765
AgaPxt03 724 0 64..786 2..716
DmPxt01-B 499 4.91e-166 198..750 214..769
DmPxt01-A 486 1.21e-160 198..750 214..791
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3555' 'join(163383..163530,163604..164240,164297..165187,165247..165943)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 163383..163530 146 N° 2 163604..164240 635 N° 3 164297..165187 889 N° 4 165247..165943 695
join(163383..163530,163604..164240,164297..165187,165247..165943)


exon

Literature and cross-references AaePxt02
Literature Nene,V. et al., "Genome sequence of Aedes aegypti, a major arbovirus vector. Science 316 (5832), 1718-1723 (2007)
Protein ref. GenBank:   AAT27427.1 UniProtKB:   P82600
DNA ref. GenBank:   AAGE02006854.1 (163383..165943)
mRNA ref. GenBank:   AY547316.1
Protein sequence: AaePxt02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   790 (774)
PWM (Da):   %s   89400.39 (87683.4) Transmb domain:   %s   i5-24o
PI (pH):   %s   6.4 (6.24) Peptide Signal:   %s   cut: 27 range:17-790
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKKVLLLSLYSAVLSTWFGFGYVQCKLPTSRSEIPNFDYTVAQQ
PDQS
DACEQNEVCMVSVECILDAKKKAILKPCSTVPSVDGVCCPSSEYNGTSSRVQQNSEEHAADHLVLQAIHEGRREYDEKLRFEDEHRAVMTAKEKPEAMFHRMFLPGGLKTHGKEVVDAEE
QANVYGHVFASRKYAELTNMTLKQRQGDRFARIPRAIRKRCLPPVPCNPHSRYRTIDGSCNNPLPDRTSWGMEGYPFDRVLEPAYEDGVWAP
RIHSVTGNLLPSARVISVALFPDEYRPD
PRLNILFMQMGQFISHDFTLSRGFTTKHGQAIECCTPNCTAPLFGPHRHFACFPIEVPPNDPFYSRFGVRCLNLVRIRLAQGPECQLGYAKQADLVTHFLDASTVYGSTNDVAAELRAFQ
QGRLKDSFPNGIELLPFARNRTACVPWARVCYEGGDIRTNQLLGLTMVHTLFMREHNRLAVGLSKINPHWDDERLYQEARRILIAEYQNVVYNEFLPILLGHERVQQLGLADPFDTYTNY
YDPNLRPMTLAEVGAAAHRYGHSLVEGFF
RFLTRESPPEDVFIKDIFNDPSKTLEPNSFDVMMFSFNQQPMEQMDRFLTYGLTRFLFKERKPFGSDLASLNIQRGRDFAVRPYNDYREWA
GLGRITDFNQLGEVGALLAQVYESPDDVDLWPGGVLEPPAEGAVVGSTFVALLSAGYTRYKRADRYYFTNGPEVNPGAFTLQQLGEIRRTTLAGIICANADHKEDFYQAQEALRQSSADN
VPVPCTRYDTVNLGLWREEGF

Retrieve as FASTA  
Remarks Complete sequence from genomic, cDNA and 45 ESTs. Same contig than AaePxt01. also called Chorion peroxidase (secreted in the chorion layer of the mature egg). Two TREMBL link P82600 and Q17CY6.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGAAAGTATTGCTGCTGAGCCTCTACTCGGCGGTGTTGTCTACGTGGTTCGGGTTCGGATATGTGCAGTGTAAACTACCCACTTCAAGGTCTGAAATTCCCAATTTTGATTAT
ACGGTTGCTCAACAGCCAGATCAAAGCG
CGGTTAGTATTAGTTTAATGTCATTAGATAAATGTCTACAAATTATAATATCACTCTACTCTTCAATGCCCACAGACGCATGCGAACAAAAT
GAAGTCTGTATGGTGTCAGTCGAGTGCATTTTGGACGCCAAAAAGAAAGCCATCTTGAAGCCATGTTCAACTGTGCCCAGCGTCGATGGAGTTTGCTGCCCGTCCAGCGAGTATAATGGA
ACTAGTAGCCGTGTTCAGCAAAACTCTGAAGAACATGCCGCTGATCACTTGGTACTGCAAGCTATTCACGAAGGTCGTCGCGAGTACGACGAGAAGCTTCGATTTGAAGATGAACACCGC
GCGGTAATGACTGCCAAGGAGAAACCAGAAGCCATGTTCCACCGTATGTTTCTTCCCGGCGGTTTGAAGACCCATGGTAAGGAAGTTGTCGATGCGGAAGAGCAAGCCAATGTTTACGGG
CATGTTTTCGCCAGCCGAAAATACGCCGAGTTGACCAATATGACCTTGAAACAGCGGCAAGGTGATAGGTTTGCGAGAATTCCCCGGGCAATTCGGAAACGCTGTTTGCCACCAGTACCT
TGCAACCCACACTCCCGCTACCGGACCATCGATGGTTCATGCAACAACCCGTTGCCGGACCGCACTAGTTGGGGTATGGAGGGTTATCCTTTTGACCGGGTTTTGGAGCCAGCGTATGAA
GATGGCGTGTGGGCACCAAG
AGGTAAGAAAATTAGTTTGTCTTTCTGACTATAGTCTAAAAGAGTATTTATGTTGCAGAATCCATTCGGTGACCGGAAACTTGCTGCCCAGTGCCCGAGT
AATCTCCGTAGCTCTTTTCCCAGATGAGTACAGACCGGATCCGCGCTTGAACATCTTGTTCATGCAGATGGGGCAGTTCATATCGCATGACTTCACTCTTAGTCGTGGTTTTACAACGAA
GCACGGGCAAGCCATCGAATGCTGTACTCCAAATTGTACGGCACCGCTTTTTGGTCCGCATCGGCATTTTGCGTGCTTCCCAATTGAAGTTCCTCCAAATGATCCGTTCTACTCCCGCTT
CGGAGTCCGCTGTTTGAACCTGGTCCGCATTCGGCTAGCGCAAGGCCCTGAATGTCAACTAGGATATGCCAAGCAAGCCGACCTGGTGACCCACTTCCTCGATGCGTCAACTGTTTACGG
TTCGACTAATGATGTAGCAGCAGAACTTCGAGCATTTCAGCAGGGTAGACTAAAGGACTCGTTTCCGAATGGTATAGAGCTGCTTCCATTCGCGAGAAATCGTACAGCTTGTGTTCCTTG
GGCACGGGTATGCTACGAAGGTGGCGACATCCGGACGAACCAGTTGCTTGGCTTAACCATGGTGCACACGTTGTTCATGAGGGAACACAACCGACTAGCTGTGGGCTTGAGTAAGATCAA
CCCTCACTGGGACGATGAACGGCTATACCAAGAGGCGCGTAGGATTCTTATAGCAGAATACCAGAATGTTGTGTACAATGAGTTCTTGCCGATCTTGCTTGGTCATGAGAGGGTACAGCA
ATTAGGATTAGCCGATCCATTTGATACGTACACAAATTACTATGATCCAAATCTTCGTCCGATGACGCTTGCTGAGGTTGGGGCTGCTGCCCATAGATACGGACATTCTCTGGTGGAAGG
TTTCTTCAG
AGGTTAGTGAGAGCTTTGGAAGGTGTTGGTTGTCCATTTATTAATTCTGATTTTCACTCAGGTTCCTTACCCGGGAATCCCCACCGGAGGACGTATTCATCAAGGATATCT
TCAACGATCCCTCCAAAACCCTCGAGCCGAACAGCTTCGACGTCATGATGTTCTCGTTCAATCAGCAGCCGATGGAACAAATGGATCGTTTCCTCACTTACGGTCTAACACGGTTCCTCT
TCAAGGAGCGTAAACCATTCGGATCGGATCTGGCATCTCTCAACATTCAACGAGGTCGGGACTTTGCCGTTCGACCATACAACGACTACCGCGAATGGGCCGGATTAGGTCGAATTACCG
ACTTTAACCAGTTAGGTGAAGTGGGTGCACTCTTGGCACAGGTTTATGAGTCTCCTGACGATGTGGATCTGTGGCCCGGAGGTGTGCTGGAACCTCCAGCGGAAGGTGCCGTAGTGGGTT
CAACATTTGTTGCTCTGTTGTCCGCTGGCTACACTCGTTACAAGCGTGCCGATCGATACTATTTCACCAACGGTCCTGAGGTAAATCCGGGGGCCTTCACTTTGCAACAACTCGGCGAGA
TAAGACGTACAACGCTGGCCGGCATAATCTGCGCCAATGCGGATCATAAGGAAGATTTCTACCAGGCCCAGGAAGCTTTAAGGCAGTCCAGCGCAGATAATGTTCCCGTTCCTTGCACCC
GCTATGACACCGTGAACTTAGGTCTGTGGCGAGAGGAAGGTTTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGAAGAAAGTATTGCTGCTGAGCCTCTACTCGGCGGTGTTGTCTACGTGGTTCGGGTTCGGATATGTGCAGTGTAAACTACCCACTTCAAGGTCTGAAATTCCCAATTTTGATTAT
ACGGTTGCTCAACAGCCAGATCAAAGCG
ACGCATGCGAACAAAATGAAGTCTGTATGGTGTCAGTCGAGTGCATTTTGGACGCCAAAAAGAAAGCCATCTTGAAGCCATGTTCAACTGTG
CCCAGCGTCGATGGAGTTTGCTGCCCGTCCAGCGAGTATAATGGAACTAGTAGCCGTGTTCAGCAAAACTCTGAAGAACATGCCGCTGATCACTTGGTACTGCAAGCTATTCACGAAGGT
CGTCGCGAGTACGACGAGAAGCTTCGATTTGAAGATGAACACCGCGCGGTAATGACTGCCAAGGAGAAACCAGAAGCCATGTTCCACCGTATGTTTCTTCCCGGCGGTTTGAAGACCCAT
GGTAAGGAAGTTGTCGATGCGGAAGAGCAAGCCAATGTTTACGGGCATGTTTTCGCCAGCCGAAAATACGCCGAGTTGACCAATATGACCTTGAAACAGCGGCAAGGTGATAGGTTTGCG
AGAATTCCCCGGGCAATTCGGAAACGCTGTTTGCCACCAGTACCTTGCAACCCACACTCCCGCTACCGGACCATCGATGGTTCATGCAACAACCCGTTGCCGGACCGCACTAGTTGGGGT
ATGGAGGGTTATCCTTTTGACCGGGTTTTGGAGCCAGCGTATGAAGATGGCGTGTGGGCACCAAG
AATCCATTCGGTGACCGGAAACTTGCTGCCCAGTGCCCGAGTAATCTCCGTAGCT
CTTTTCCCAGATGAGTACAGACCGGATCCGCGCTTGAACATCTTGTTCATGCAGATGGGGCAGTTCATATCGCATGACTTCACTCTTAGTCGTGGTTTTACAACGAAGCACGGGCAAGCC
ATCGAATGCTGTACTCCAAATTGTACGGCACCGCTTTTTGGTCCGCATCGGCATTTTGCGTGCTTCCCAATTGAAGTTCCTCCAAATGATCCGTTCTACTCCCGCTTCGGAGTCCGCTGT
TTGAACCTGGTCCGCATTCGGCTAGCGCAAGGCCCTGAATGTCAACTAGGATATGCCAAGCAAGCCGACCTGGTGACCCACTTCCTCGATGCGTCAACTGTTTACGGTTCGACTAATGAT
GTAGCAGCAGAACTTCGAGCATTTCAGCAGGGTAGACTAAAGGACTCGTTTCCGAATGGTATAGAGCTGCTTCCATTCGCGAGAAATCGTACAGCTTGTGTTCCTTGGGCACGGGTATGC
TACGAAGGTGGCGACATCCGGACGAACCAGTTGCTTGGCTTAACCATGGTGCACACGTTGTTCATGAGGGAACACAACCGACTAGCTGTGGGCTTGAGTAAGATCAACCCTCACTGGGAC
GATGAACGGCTATACCAAGAGGCGCGTAGGATTCTTATAGCAGAATACCAGAATGTTGTGTACAATGAGTTCTTGCCGATCTTGCTTGGTCATGAGAGGGTACAGCAATTAGGATTAGCC
GATCCATTTGATACGTACACAAATTACTATGATCCAAATCTTCGTCCGATGACGCTTGCTGAGGTTGGGGCTGCTGCCCATAGATACGGACATTCTCTGGTGGAAGGTTTCTTCAG
GTTC
CTTACCCGGGAATCCCCACCGGAGGACGTATTCATCAAGGATATCTTCAACGATCCCTCCAAAACCCTCGAGCCGAACAGCTTCGACGTCATGATGTTCTCGTTCAATCAGCAGCCGATG
GAACAAATGGATCGTTTCCTCACTTACGGTCTAACACGGTTCCTCTTCAAGGAGCGTAAACCATTCGGATCGGATCTGGCATCTCTCAACATTCAACGAGGTCGGGACTTTGCCGTTCGA
CCATACAACGACTACCGCGAATGGGCCGGATTAGGTCGAATTACCGACTTTAACCAGTTAGGTGAAGTGGGTGCACTCTTGGCACAGGTTTATGAGTCTCCTGACGATGTGGATCTGTGG
CCCGGAGGTGTGCTGGAACCTCCAGCGGAAGGTGCCGTAGTGGGTTCAACATTTGTTGCTCTGTTGTCCGCTGGCTACACTCGTTACAAGCGTGCCGATCGATACTATTTCACCAACGGT
CCTGAGGTAAATCCGGGGGCCTTCACTTTGCAACAACTCGGCGAGATAAGACGTACAACGCTGGCCGGCATAATCTGCGCCAATGCGGATCATAAGGAAGATTTCTACCAGGCCCAGGAA
GCTTTAAGGCAGTCCAGCGCAGATAATGTTCCCGTTCCTTGCACCCGCTATGACACCGTGAACTTAGGTCTGTGGCGAGAGGAAGGTTTTTAA

Retrieve as FASTA