Entry information : MtPrx33 (Medtr7g072480.1[4.0] / Medtr7g072480.1[3.5] / Medtr7g077870.1[3.0])
Entry ID 358
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2013-12-30 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx33 (Medtr7g072480.1[4.0] / Medtr7g072480.1[3.5] / Medtr7g077870.1[3.0])
Name (synonym) MtPrx33 (Medtr7g072480.1[4.0] / Medtr7g072480.1[3.5] / Medtr7g077870.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Roots
Inducers Aphanomyces euteiches zoospores infection
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Glomus intraradices infection
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx33
start..stop
S start..stop
GmPrx188 503 0 1..316 1..316
GmPrx52 495 9e-179 1..316 1..316
MtPrx36 491 4e-177 5..316 1..312
LjPrx10 483 8e-174 1..316 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26950040..26950246 207 N° 2 26950910..26951101 192 N° 3 26951448..26951613 166 N° 4 26951788..26952173 386
join(26950040..26950246,26950910..26951101,26951448..26951613,26951788..26952173 )


exon

Literature and cross-references MtPrx33 (Medtr7g072480.1[4.0] / Medtr7g072480.1[3.5] / Medtr7g077870.1[3.0])
Literature Torres-Jerez,I. et al., unpublished
DNA ref. Phytozome 12:   chr7 (26950040..26952173)
EST ref. GenBank:   BG648734.1 [5' end]   CB892728.1 [3' end]
Cluster/Prediction ref. Phytozome Gene 12:   31082529 UniGene:   Mtr.5571
Omic ref. Gene atlas:   Mtr.40120.1.S1_at Legoo:   Mtr.40120.1.S1_at
Protein sequence: MtPrx33 (Medtr7g072480.1[4.0] / Medtr7g072480.1[3.5] / Medtr7g077870.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   317 (294)
PWM (Da):   %s   34327.25 (31801.9)  
PI (pH):   %s   8.33 (8.21) Peptide Signal:   %s   cut: 23 range:23-316
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNLPITKVHFIVLFCLIGTISAQLSSNFYFRTCPLVLSTIKKEVISALINERRMGASLLRLHFHDCFVQGCDASVLLDDTSSFRGEKTAGPNANSLRGFDVIDKIKSEVEKLCPNTVSCADILAVAARDSVVALGGLSWTVQLGRRDSTTASFGLANSDLPGPGSDLSGLINAFNNKGFTPKEMVALSGSHTIGEASCRFFRTRIYNENNIDSSFANSLQSSCPRTGGDLNLSPLDTTSPNTFDNAYFKNLQNQKGLFHSDQVLFDEVTTKSQVNSYVRNPLSFKVDFANAMFKMANLGPLTGSSGQVRKNCRSVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 7, 3 introns) and 51 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACCTTCCAATCACCAAAGTTCATTTTATTGTACTCTTTTGCCTTATTGGCACAATTTCAGCTCAATTATCCTCTAATTTTTACTTCAGAACGTGTCCTCTTGTGCTTTCAACCATT
AAAAAAGAAGTAATTTCTGCTTTGATCAATGAACGTCGCATGGGAGCCTCTCTACTCCGTCTTCATTTCCATGATTGTTTTGTTCAA
GCAAGTGATCCTTTCACTTTTTCTCTTCTTTCT
CTAATTTATGTAACATAAATAATTTATTTTTAAGACATGATCTTACACATTTGCATACTCGTTCACTTATTAAATTGTTAGGTATGATACATTTTCATTATAAGCACTAAAATTACTTTC
TAAATATTTTGGAGGCATTTTGTGTAGTGAAGTATGATGAAACTCAAATGTGGAATATATAGTTATAATTGATAGACAGTGGAAACAATTTTTACACTGTCAATATATATGAATTAAACA
ATGATTCAATTAGTATACTATAATAAAAAATTAATATGATATAAAAATCTATCTAATTAGTTTAAAACAAGACAACACACATACCCCTAGACATATTTTAACTAAAATATTTTGAAAATT
GGACTTTTCCAAAAAAAAAAAAAAAATTGTTTGAAAATTGTCAGCAATCTGTTAAATAAGACCAACTGGTTGATTTATTTATTATTTGTTTTGAACAAAACTCAACAAACAATCATGCTT
AGTTAACTTCTTTAGTAACAAGTGATGAAAACAAATTTTTTTCTTAAAAAAGAATTGATGAAAATGACAAATAATTAGTTAAATGAATTCCTTAAAATTAAAATTATTATCTCTAATAAT
TTTGTCCATGCATATTGTTTTTATTTTTAGGGATGTGATGCATCAGTACTTTTGGACGATACATCAAGTTTCAGAGGTGAAAAAACAGCAGGTCCAAACGCTAATTCACTGAGAGGCTTT
GATGTAATTGACAAAATAAAGTCTGAAGTAGAGAAGTTATGCCCTAATACTGTCTCTTGTGCTGATATTCTTGCTGTGGCAGCAAGAGATTCCGTGGTGGCG
GTAAGTATACATTCTTTA
AGTCAAAACTTTTCTTTAAGGGCTTACTTCAAGCTTAAAAATAGAGTATTTCGTAATCATTTTTAATTCATTGATTGAATGTGTAAAATACGTAATCTATACAAACGAAAAAGAAAAAAA
AAACTTTAATGTTGGTCATACTTAGAGACAAATTTCATGTTTTCTTTTCTTGTATGTTATATCGTTAATTAATCCAAATTTTTAGTAGATTTATACACTAGAAAAGGACTTATATGGTCA
TAAGGTTTAGATTTAGGTACACAAAAAATGATTAAAAAAACAAAATATATAGTGTTCCGAAATAATTTGTATATTGAACACATTTCAGCTTGGTGGACTTAGTTGGACTGTTCAATTGGG
AAGAAGGGATTCAACCACAGCAAGTTTTGGTTTAGCTAACTCAGATTTACCTGGTCCTGGTTCTGATCTAAGTGGCCTTATCAATGCTTTTAACAATAAAGGTTTCACACCCAAAGAAAT
GGTTGCTTTATCAG
GTAACTATAGTTACTTTTAGTTCCTTTAACATGTGCAATATTACACATGTCAGAAAAACCCTAATTTTATTATTACTAGCGTTTAGGCACTCTGGTGTCCGTCTAT
CCAGTTTTCATACCATATGATAAACATGTCTCATTATCAATTGTATAACTAACTTTATTGTATTATAGGATCACACACAATTGGTGAAGCTAGTTGTAGATTCTTCAGAACAAGGATTTA
CAATGAAAACAACATAGATTCATCTTTTGCAAATTCATTGCAATCAAGTTGTCCCAGAACAGGTGGTGATTTAAATTTGTCCCCACTTGACACAACCTCTCCAAATACATTTGACAATGC
TTATTTCAAGAACTTGCAAAACCAAAAAGGTCTCTTTCACTCTGATCAAGTGCTTTTCGATGAAGTAACCACAAAATCACAAGTTAATTCTTATGTTAGAAACCCTTTGAGTTTCAAAGT
TGATTTTGCCAATGCAATGTTCAAAATGGCGAACCTTGGCCCACTTACGGGGTCTAGTGGTCAAGTTCGAAAAAATTGTAGGAGTGTCAACTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACCTTCCAATCACCAAAGTTCATTTTATTGTACTCTTTTGCCTTATTGGCACAATTTCAGCTCAATTATCCTCTAATTTTTACTTCAGAACGTGTCCTCTTGTGCTTTCAACCATT
AAAAAAGAAGTAATTTCTGCTTTGATCAATGAACGTCGCATGGGAGCCTCTCTACTCCGTCTTCATTTCCATGATTGTTTTGTTCAA
GGATGTGATGCATCAGTACTTTTGGACGATACA
TCAAGTTTCAGAGGTGAAAAAACAGCAGGTCCAAACGCTAATTCACTGAGAGGCTTTGATGTAATTGACAAAATAAAGTCTGAAGTAGAGAAGTTATGCCCTAATACTGTCTCTTGTGCT
GATATTCTTGCTGTGGCAGCAAGAGATTCCGTGGTGGCG
CTTGGTGGACTTAGTTGGACTGTTCAATTGGGAAGAAGGGATTCAACCACAGCAAGTTTTGGTTTAGCTAACTCAGATTTA
CCTGGTCCTGGTTCTGATCTAAGTGGCCTTATCAATGCTTTTAACAATAAAGGTTTCACACCCAAAGAAATGGTTGCTTTATCAG
GATCACACACAATTGGTGAAGCTAGTTGTAGATTC
TTCAGAACAAGGATTTACAATGAAAACAACATAGATTCATCTTTTGCAAATTCATTGCAATCAAGTTGTCCCAGAACAGGTGGTGATTTAAATTTGTCCCCACTTGACACAACCTCTCCA
AATACATTTGACAATGCTTATTTCAAGAACTTGCAAAACCAAAAAGGTCTCTTTCACTCTGATCAAGTGCTTTTCGATGAAGTAACCACAAAATCACAAGTTAATTCTTATGTTAGAAAC
CCTTTGAGTTTCAAAGTTGATTTTGCCAATGCAATGTTCAAAATGGCGAACCTTGGCCCACTTACGGGGTCTAGTGGTCAAGTTCGAAAAAATTGTAGGAGTGTCAACTAA

Retrieve as FASTA