Entry information : MtPrx35 (Medtr2g029910.1 [4.0] / Medtr2g029910.1 [3.5] / AC234842_7.1[3.0] )
Entry ID 360
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2010-09-16 (Haythem Mhadhbi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-16 (Christophe Dunand)
Peroxidase information: MtPrx35 (Medtr2g029910.1 [4.0] / Medtr2g029910.1 [3.5] / AC234842_7.1[3.0] )
Name (synonym) MtPrx35 (Medtr2g029910.1 [4.0] / Medtr2g029910.1 [3.5] / AC234842_7.1[3.0] )
Class Class III peroxidase     [Orthogroup: Prx043]*
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots
Inducers Glomus intraradices infection
Glomus mosseae infection
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx35
start..stop
S start..stop
MsPrx15 521 0 1..353 1..353
MtPrx15 516 0 4..353 3..352
PvPrx08 502 2e-180 11..353 12..355
GmPrx24 501 7e-180 11..353 7..350
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11192286..11192510 225 N° 2 11191874..11192065 192 N° 3 11191242..11191407 166 N° 4 11190636..11191114 479
complement(join(11190636..11191114,11191242..11191407,11191874..11192065,1119228 6..11192510))


exon

Literature and cross-references MtPrx35 (Medtr2g029910.1 [4.0] / Medtr2g029910.1 [3.5] / AC234842_7.1[3.0] )
Literature REFERENCE 1. Journet,E.P. et al., unpublished
REFERENCE 2. Natalija Hohnjec, Martin F. Vieweg, Alfred Puhler, Anke Becker, and Helge Kuster. Overlaps in the Transcriptional Profiles of Medicago truncatula Roots Inoculated with Two Different Glomus Fungi Provide Insights into the Genetic Program Activated during Arbuscular Mycorrhiza. Plant Physiol. 137: 1283-1301(2005).
DNA ref. Phytozome 12:   chr2 (11192510..11190636)
Cluster/Prediction ref. Phytozome Gene 12:   31067124
Omic ref. Gene atlas:   Mtr.10373.1.S1_at Legoo:   Mtr.10373.1.S1_at
Protein sequence: MtPrx35 (Medtr2g029910.1 [4.0] / Medtr2g029910.1 [3.5] / AC234842_7.1[3.0] )
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   353 (333)
PWM (Da):   %s   37536.69 (35478.6) Transmb domain:   %s   i5-24o
PI (pH):   %s   4.3 (4.24) Peptide Signal:   %s   cut: 29 range:21-353
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MNSSFHLTLAALCCVVVVLGGFPFSSNAQLDPNFYKDTCPNVTSIVQSILANVSQTDPRILASFIRLHFHDCFVQGCDASLLLNDSDTIVSEQGALPNRNSIRGLDIVNQIKAAIELACPSVVSCADILALGANVSSVLALGPDWEVPLGRRDSFNANQSLANSSLPGPRFLLDELKTSFLNQGLDTTDLVALSGAHTIGRGVCLLFNDRMYNFNNTGVPDPTLNTTLLQSLQAICPDIGVLGTNLTNLDVSTPDTFDSNYYSNLQAGNGLFQSDQELFSTPGADTIAIVNSFSSNQTLFFEAFKASMIKMGNIGVLTGTQGEVRTHCNFVNTVSLATKVTKDSSEDGIVSSF

Retrieve as FASTA  
Remarks Complete sequence from 26 ESTs and genomic sequence (chromo 2, 3 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCTTCTTTTCATCTCACATTAGCAGCTTTGTGCTGTGTAGTGGTTGTGCTTGGAGGGTTTCCCTTCTCTTCAAATGCACAACTTGATCCTAACTTCTATAAGGACACATGTCCA
AATGTCACTTCCATTGTCCAAAGTATCTTAGCAAACGTTTCTCAGACAGATCCTCGTATCCTTGCCAGTTTCATTAGGCTTCATTTTCATGATTGTTTTGTTCAA
GTATGTATTATATTA
TATATAATATATAATAATTGCGATGTGATATTGTTGAAGCCACAACGAGTTTGATAGAATCACAAAGAACATGTGATTTTGTTGAAAGTTTAAAGTGTCAATGCTACGACGTGATTCTAT
CAAACTAACTGTAAATTTCTCACCAACATCTAACTAAGTTTTGGATATTTGTAACTCATATATTTGATATCTATGTTTATGAAAGGGTTGTGATGCATCACTCTTGTTGAATGACTCTGA
TACTATCGTGAGTGAGCAAGGAGCTTTGCCAAATAGAAACTCAATAAGAGGTTTGGATATTGTGAATCAAATCAAAGCCGCAATCGAACTTGCTTGTCCTAGTGTTGTGTCTTGTGCAGA
TATTCTTGCACTTGGTGCTAATGTTTCCTCCGTTCTG
GTACGTTTCACATCCTCTATATATTATTGACATTTTCTCTATCTCGTTCACAAGACGACCCAGTAATTTTTAATAGTAATTGA
GACATAAAACAAGTTTTCATGTATATGATATTTTTTGTCAACTACTCAAGGAGAGAGAAAAAAAAAATGTAAAATGAGTTGATGAATTTGTTATACAAGTCATTAGTAATGAAAGTCTCT
TAGCCGGCCATCTTTGATGCTAGGTTTCTTCATAGTACTAAAAAATGTTTGGGATTTCATCTGTAAATAACTTGAAAGTTTCAAACTAAATATAAAAAGATCAATCAATAAAAATATATT
ATTTTAAGTATCAACCTTCATTTTTTATTGTTATGATTTTAGTTCTGGCAAATATACTGCTTTTTATTTCTGGTTATTATTATTTTTTAATCCTACTAGTGTGAGACCATAATTTTTTAC
TTGTGTCACATTTTTCCTCGCAGGCTCTTGGTCCTGATTGGGAAGTTCCATTAGGAAGAAGAGATAGTTTCAATGCAAATCAAAGTCTTGCTAATTCAAGCCTTCCTGGTCCCCGATTTC
TTCTTGATGAATTAAAAACCTCCTTTCTTAATCAAGGTCTCGACACTACTGATCTTGTTGCACTTTCAG
GTATAAATGTTTGTCTCCTTAAAATCTATATCTCTACACATAACATGTGTA
CATTTTACAACCGTTTCGGAGGAGATTTAAACTCGATACTTGGTGTCTAATTGTATATGCTTTGATCATTTTTTAGGTGCTCATACGATTGGAAGAGGTGTATGCCTTTTATTCAATGAT
CGAATGTACAATTTCAATAACACCGGAGTTCCTGATCCAACTCTAAACACAACCTTACTACAATCATTGCAAGCAATATGCCCAGATATTGGCGTTCTAGGTACCAACCTCACCAATTTG
GATGTAAGCACTCCCGATACATTCGACTCAAACTACTACTCCAATCTTCAAGCTGGAAATGGTTTGTTTCAGAGTGATCAAGAGCTTTTTTCCACACCTGGTGCTGATACCATTGCCATT
GTTAATAGCTTTAGCAGCAATCAAACTCTTTTCTTTGAAGCTTTTAAGGCCTCCATGATTAAGATGGGTAATATTGGAGTGTTAACTGGAACTCAAGGTGAAGTTAGAACACACTGTAAC
TTTGTTAATACTGTTAGTCTTGCTACCAAAGTCACCAAAGATTCATCAGAAGATGGTATTGTTAGCTCATTCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAACTCTTCTTTTCATCTCACATTAGCAGCTTTGTGCTGTGTAGTGGTTGTGCTTGGAGGGTTTCCCTTCTCTTCAAATGCACAACTTGATCCTAACTTCTATAAGGACACATGTCCA
AATGTCACTTCCATTGTCCAAAGTATCTTAGCAAACGTTTCTCAGACAGATCCTCGTATCCTTGCCAGTTTCATTAGGCTTCATTTTCATGATTGTTTTGTTCAA
GGTTGTGATGCATCA
CTCTTGTTGAATGACTCTGATACTATCGTGAGTGAGCAAGGAGCTTTGCCAAATAGAAACTCAATAAGAGGTTTGGATATTGTGAATCAAATCAAAGCCGCAATCGAACTTGCTTGTCCT
AGTGTTGTGTCTTGTGCAGATATTCTTGCACTTGGTGCTAATGTTTCCTCCGTTCTG
GCTCTTGGTCCTGATTGGGAAGTTCCATTAGGAAGAAGAGATAGTTTCAATGCAAATCAAAGT
CTTGCTAATTCAAGCCTTCCTGGTCCCCGATTTCTTCTTGATGAATTAAAAACCTCCTTTCTTAATCAAGGTCTCGACACTACTGATCTTGTTGCACTTTCAG
GTGCTCATACGATTGGA
AGAGGTGTATGCCTTTTATTCAATGATCGAATGTACAATTTCAATAACACCGGAGTTCCTGATCCAACTCTAAACACAACCTTACTACAATCATTGCAAGCAATATGCCCAGATATTGGC
GTTCTAGGTACCAACCTCACCAATTTGGATGTAAGCACTCCCGATACATTCGACTCAAACTACTACTCCAATCTTCAAGCTGGAAATGGTTTGTTTCAGAGTGATCAAGAGCTTTTTTCC
ACACCTGGTGCTGATACCATTGCCATTGTTAATAGCTTTAGCAGCAATCAAACTCTTTTCTTTGAAGCTTTTAAGGCCTCCATGATTAAGATGGGTAATATTGGAGTGTTAACTGGAACT
CAAGGTGAAGTTAGAACACACTGTAACTTTGTTAATACTGTTAGTCTTGCTACCAAAGTCACCAAAGATTCATCAGAAGATGGTATTGTTAGCTCATTCTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AGGTACGCGG GGACAATTAA ATTTCAAGAG TTCAAAAAAC AATAGAAATA ATAATGAACT CTTCTTTTCA TCTCACATTA GCAGCTTTGT GCTGTGTAGT GGTTGTGCTT GGAGGGTTTC  CCTTCTCTTC AAATGCACAA CTTGATCCTA ACTTCTATAA GGACACATGT CCAAATGTCA CTTCCATTGT CCAAAGTATC TTAGCAAACG TTTCTCAGAC AGATCCTCGT ATCCTTGCCA  GTTTCATTAG GCTTCATTTT CATGATTGTT TTGTTCAAGG TTGTGATGCA TCACTCTTGT TGAATGACTC TGATACTATC GTGAGTGAGC AAGGAGCTTT GCCAAATAGA AACTCAATAA  GAGGTTTGGA TATTGTGAAT CAAATCAAAG CCGCAATCGA ACTTGCTTGT CCTAGTGTTG TGTCTTGTGC AGATATTCTT GCACTTGGTG CTAATGTTTC CTCCGTTCTG GCTCTTGGTC  CTGATTGGGA AGTTCCATTA GGAAGAAGAG ATAGTTTCAA TGCAAATCAA AGTCTTGCTA ATTCAAGCCT TCCTGGTCCC CGATTTCTTC TTGATGAATT AAAAACCTCC TTTCTTAATC  AAGGTCTCGA CACTACTGAT CTTGTTGCAC TTTCAGGTGC TCATACGATT GGAAGAGGTG TATGCCTTTT ATTCAATGAT CGAATGTACA ATTTCAATAA CACCGGAGTT CCTGATCCAA  CTCTAAACAC AACCTTACTA CAATCATTGC AAGCAATATG CCCAGATATT GGCGTTCTAG GTACCAACCT CACCAATTTG GATGTAAGCA CTCCCGATAC ATTCGACTCA AACTACTACT  CCAATCTTCA AGCTGGAAAT GGTTTGTTTC AGAGTGATCA AGAGCTTTTT TCCACACCTG GTGCTGATAC CATTGCCATT GTTAATAGCT TTAGCAGCAA TCAAACTCTT TTCTTTGAAG  CTTTTAAGGC CTCCATGATT AAGATGGGTA ATATTGGAGT GTTAACTGGA ACTCAAGGTG AAGTTAGAAC ACACTGTAAC TTTGTTAATA CTGTTAGTCT TGCTACCAAA GTCACCAAAG  ATTCATCAGA AGATGGTATT GTTAGCTCAT TCTAAGTAAT TTAAGACAAG TTGCATAAGA AAGGTATCTA CCCAATAAAG AGTGTTTTCT AGGGGCACAT ATATACATGT GCTCTTTTGT  GGATTGTGAT ATGTTTTGTA TTTTATTTTG TAATCTATGG CTACTGAATG CAGTGTGTTT GTAAGTTCTA TTTCGCTCTA TTATGATAAT TATGTCATAT TAATAAAATT GTGTATGTAA 
AAAAAAGGTT TGATCACTTT CAGTTT 

Retrieve as FASTA