Entry information : HsGPx03 (GSHPx-3 / GPx-3)
Entry ID 3602
Creation 2007-01-04 (Marcia Pinheiro Margis)
Last sequence changes 2010-11-08 (Myriam Duval)
Sequence status complete
Reviewer Harold Duruflé
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: HsGPx03 (GSHPx-3 / GPx-3)
Name (synonym) HsGPx03 (GSHPx-3 / GPx-3)
Class Animal glutathione peroxidase    [Orthogroup: Gpx1001]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsGPx03
start..stop
S start..stop
PtroGPx03 468 8e-171 1..226 1..226
PpyGPx03 463 3e-169 1..226 1..226
HlGPx03 431 3e-156 1..226 1..226
MmulGPx03 427 6e-155 1..226 1..226
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 150400216..150400302 87 N° 2 150404901..150405054 154 N° 3 150406461..150406578 118 N° 4 150406993..150407092 100
N° 5 150407470..150407688 219  
join(150400216..150400302,150404901..150405054,150406461..150406578,150406993..1 50407092,150407470..150407688)


exon

Literature and cross-references HsGPx03 (GSHPx-3 / GPx-3)
Literature REFERENCE 1 Takahashi K., Akasaka M., Yamamoto Y., Kobayashi C., Mizoguchi J., Koyama J.Primary structure of human plasma glutathione peroxidase deduced from cDNA sequences.J. Biochem. 108:145-148(1990).

REFERENCE 2 Chu F.-F., Esworthy R.S., Doroshow J.H., Doan K., Liu X.F. Expression of plasma glutathione peroxidase in human liver in addition to kidney, heart, lung, and breast in humans and rodents. Blood 79:3233-3238(1992).

REFERENCE 3 Yoshimura S., Suemizu H., Taniguchi Y., Arimori K., Kawabe N., Moriuchi T.The human plasma glutathione peroxidase-encoding gene: organization, sequence and localization to chromosome 5q32.Gene 145:293-297(1994).

REFERENCE 4 Comhair S.A.A., Thomassen M.J., Erzurum S.C.Differential induction of extracellular glutathione peroxidase and nitric oxide synthase 2 in airways of healthy individuals exposed to 100% O(2) or cigarette smoke. Am. J. Respir. Cell Mol. Biol. 23:350-354(2000).
Protein ref. UniProtKB:   P22352
DNA ref. GenBank:   NC_000005.9 (150400216..150407688)
Cluster/Prediction ref. Genebank:   2878 UniGene:   Hs.386793
Protein sequence: HsGPx03 (GSHPx-3 / GPx-3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   226 (202)
PWM (Da):   %s   25257.86 (22742.5)  
PI (pH):   %s   7.44 (6.52) Peptide Signal:   %s   cut: 25 range:25-226
Sequence 267
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MARLLQASCLLSLLLAGFVSQSRGQEKSKMDCHGGISGTIYEYGALTIDGEEYIPFKQYAGKYVLFVNVASYUGLTGQYIELNALQEELAPFGLVILGFPCNQFGKQEPGENSEILPTLKYVRPGGGFVPNFQLFEKGDVNGEKEQKFYTFLKNSCPPTSELLGTSDRLFWEPMKVHDIRWNFEKFLVGPDGIPIMRWHHRTTVSNVKMDILSYMRRQAALGVKRK

Retrieve as FASTA  
Remarks Complete sequence from 1444 ESTs, 8 cDNA and DNA (chrom V). 5 exons.
Promoter
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCATGGTGTT AACATGTTGC TAGGTGCCTA TTTTGAGGGT CACTAGATGC CTACTGATAC TAATGAACAA TGGATTTCTG ACAAACTGAT GTGCACACAG ATGTTTATAT TTTAGGGTAA  ATACGAACCT TAAAAGACAA CAGAACAACA TGGAGAGGGC CTGAGACTGA GTCTAGAGAC CTGGATTCTG GTTCCCTCCC TGCCATCAGT TGGTTATGGG AACTTGGATA AATTGCTCCT  CATCTCTAGG CTTCAGGGAA ATGAGGTGGT TGAATAAAAC GTATTGAGCA CTTACTGTGT GTCAGCCATT GTTCATATGC TCCCAGGCTT TAACTCAGCT AAAGACTTCC TGGCCTCTGT  GGTTCCTTCC ACTTCAACAG GCTGTGGTTT GAGGTGGGAA GACTTCGTAG AGAATGCAAA ACTTGAGAGA CATCTTCCAA ATTCCCAGGG GGATGTTAAT ACCTTTAATC ATAGTAAAGG  TATGGTTTCT CAAGGCATTT CTTGGTCAGA AGAAAGTTCC AGAAGGCACT TAATCCTAGG ACTCACACTA CCAAGGCTAC AGCCAGGCCA ACTGCCTCAC AATAACCTTA GAACATGTCT  GAAGACAGAT TTTCAGCTTC TGCCCCTAGA GATTCTAATG CAGTGATTCC AAAGTGGGGT CCAGGAATCT GTATTAAAGG CTTCCCAGTT GACTCTGGTG GTCAGAGAGA TTTGAGACTG  ATTCCATCAC ATTCCCCATC TGTGAACGGG ATCATACCTA GACAGCCCAG CCCTAGAACT GCCTGGTCTG ATCCTAAGTG TTCCATGGAG ATTTTGTTTT TTTAATGTAA TGAATGATTA  AGTCAGCAAA TACTTTACAT CTCTTGTGTG CTAGGCCCTG TGCCAGGTGG TGATTATGGG CCCTATTCTC AAAGGACTCC TGGTCTCCGT CTGTCACTTA CTTTAGAAAC AAGTCATCTA  GCCAGAGCCA GAAGGGCACT GGAGATCACT AATCAATCCC ATCATTACAT AGCTGAGGAA ACTGAGGCCC AGAGAGTAAC TGCAACATGT TAAAGACTAC ACAGGGAGCA AATTTATTTT  CTGCTTCTAA GCCAGGTGGT TTGGCCACAG ATAGGCCAAG AAGAATACGA ACAGACAAGC CTTGCTGGGT TTCCCACTCA GTTTATTACT ATTAGACCAT TCCCTTTTTC CCCACTCACA  TTTCTGCGCA TTTCCATGGT CTTCATAGAA TCTAAGCCTA AAAATAGAGT TTTCCTTGAG TCTTTGGGTC TTCATTTCTG AAGACTCTCA TGTCACAGAA AACTTTAATT AAATAAATCG  TTATGCTTTT CTCTTGCTAA CCTTTTTCTA CAGGCATGTC AGCTGTGATC CTTATGATGG GGAGGAAAGG CACCCCACCT TCTCTGTCCC TACAGTCCTA ATGCCCTACC CAGAATGGGG  TTTTCAAAAT CCCAGGACAC CCACTCTTTG TTTCTTAAGC ACTAAACCTA TATATAGTAA ATGTTTCTGG AAGTTTAACT TCAGCTCTTG CTGAAATTTT AAACCCTCAA TTTCCAGAGG  ACCATCGCCA GGTGTTTTTA AAACCTCGAT AGGAATAAGA AATGCTTCCC AGAATGGAGA CTTCCATCAG TTCTAGGGAG CTATTAGCCC CCTTGCCCTG GCTGTAATGG AGACCGCTGT  GTCTGCCTCC TTTCGCACTT TGGAGCCAAA AGAGGAAGGG ACCGCCTCCC ACGTCCACAG GGACCTGACT TCCACCTCTC TGCCCAGATT TGCTTATGTC ACTGTCGCCC CGGGACGGGG  AGGTGGGGAG CTGAGGGCAA GTCGCGCCCG CCCCTGAAAT CCCAGCCGCC TAGCGATTGG CTGCAAGGGT CTCGGCTTGG CCGCGGATTG GTCACACCCG AGGGCTTGAA AGGTGGCTGG 
GAGCGCCGGA CACCTCAGAC GGACGGTGGC CAGGGATCAG GCAGCGGCTC AGGCGACCCT GAGTGTGCCC CCACCCCGCC 

Retrieve as FASTA  
Terminator +
Send to BLAST
Send to cis Analysis
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTGAAGGCCG TCTCATCCCA TGTCCACCAT GTAGGGGAGG GACTTTGTTC AGGAAGAAAT CCGTGTCTCC AACCACACTA TCTACCCATC ACAGACCCCT TTCCTATCAC TCAAGGCCCC  AGCCTGGCAC AAATGGATGC ATACAGTTCT GTGTACTGCC AGGCATGTGG GTGTGGGTGC ATGTGGGTGT TTACACACAT GCCTACAGGT ATGCGTGATT GTGTGTGTGT GCATGGGTGT  ACAGCCACGT GTCTACCTAT GTGTCTTTCT GGGAATGTGT ACCATCTGTG TGCCTGCAGC TGTGTAGTGC TGGACAGTGA CAACCCTTTC TCTCCAGTTC TCCACTCCAA TGATAATAGT  TCACTTACAC CTAAACCCAA AGGAAAAACC AGCTCTAGGT CCAATTGTTC TGCTCTAACT GATACCTCAA CCTTGGGGCC AGCATCTCCC ACTGCCTCCA AATATTAGTA ACTATGACTG  ACGTCCCCAG AAGTTTCTGG GTCTACCACA CTCCCCAACC CCCCACTCCT ACTTCCTGAA GGGCCCTCCC AAGGCTACAT CCCCACCCCA CAGTTCTCCC TGAGAGAGAT CAACCTCCCT  GAGATCAACC AAGGCAGATG TGACAGCAAG GGCCACGGAC CCCATGGCAG GGGTGGCGTC TTCATGAGGG AGGGGCCCAA AGCCCTTGTG GGCGGACCTC CCCTGAGCCT GTCTGAGGGG  CCAGCCCTTA GTGCATTCAG GCTAAGGCCC CTGGGCAGGG ATGCCACCCC TGCTCCTTCG GAGGACGTGC CCTCACCCCT CACTGGTCCA CTGGCTTGAG ACTCACCCCG TCTGCCCAGT  AAAAGCCTTT CTGCAGCAGC TGAGCCTACT GTGTGTGGTG CTTCTTCAAT GGTGGCCGCC CCCGCCTGGG TGGGAAGTGA GGAGGAGAAG GTGGGGCAGG GTAAAGGGGG GAGGATGAGA 
AAAGAACAAA TATGACAACA AAAACTTTTT ACAGTGGGTG C 

Retrieve as FASTA  
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGGGACAAGAGAAGTCGAAGGTGAGTGAGCCTCCGGGCCGGGGGCCGGGAGAAA
AAACCTAGCCCCTCGGTGTCCAGCGCTCAGTGCAATGCACCCCTTTTCCCAGGCTCCCCGCCAGATGGGCAATCCCCAGGTGCGAGAGACCTCCTGAACCCCTTTTGCCGCCCCCTCCGC
CGCCGGGACCCCGCCCCCGACCGTCGTCGTCTCGTAGTTCCATCTGTTGGAGAGCCGAGACCTGGTGCTTCAGGCGGGCAGAATGACTAAGGGAGGAAGGTCTCTCTCCCCGAGCTCGCA
CTTTCTCCCCACTGCCACCTCGAGGGTCGCCTTGCTACATCTATGTCACCTCCGTGCCTGAGCTGCTCCCCTTCAGTAGGGCCTAAGAGGGAGGGCGTCACAGAAAAAAATGCCCAGCGT
CTGGGTGGGCTGTGCAAGTTCCCAGGGAGAGAGACAAGGAGAAAGGAGAGAGGCAGCTGGGTGGTCCTGGTCCTGAAGAACTGCTGTGGGGGGCTCTTCTACCCCAAGAATGATACAGGC
AGGTAGAAATGGCCACTTGGATTCAGGGCATTGGTAGAAGAGGCAGAGATCTGTGCTAGAAAGAGCTCTGGAGTGACAGTGCAGAACACTCAGGACCCTGAGTCCTTACCTGCTCCTGGA
CCCCCGTTTCTCCATCTGCAGGGGAGAGTTTGGGGGTGGGAGTGCATGGGGCACAATGAAGCTGAGGGCCTCAGAGGGGATGCTTGGAGAAGCTGAAAAATCCACAAGCTGTTCTCTGAA
ATTTCCTCCCCTGGGGCAGCCTCACTACCCAGGACCCACTGTCCTCATTAGCCTGAGGAAACCTGGTAGTTGGAGAAAGCTGGGGACTGCTAATTCAGAAGAAGAGGTAGAATTCTCTAG
AGCCTCAGTCTATTTCCAGCAGGTGTGTGGCCCACACCTGGAGTGGGGATACTGAGGCCAGGAGTGGGATGACCCAGCATGCTTATCTCCTTTGACAGTATGTACTGGGGTGGGCTCTGT
AGACCTCTCCTCTACCCAGGGAGTGGGAGTGGGTGGGGAAGGAGGCAGAAGCCAGGTGTAGGGATAGACTCAAAGCGAGCGATTTCTGTCTCCAACTTCCCAACATGCATAACTCACATT
TTTGCAAGCTCTGAGCTTTTGTTTCTAAAATCCTCTGGGTCTTCACTTTAATTAAGTTCTTATGAGTCTAGGATTCCGTTTCCAAAATTCTGTCCACTTCTCAGGAAGCCCATTGGAAGC
ACAGGGTTCCTTCCATGTTACTCACCCCTTTTCGGTCCTCAGCCTAAATCCGATTAATCAGCCTCTCCTTGGAGTCAGTCTAAATGGATGTGAAGCCACTTCGTCCAAGTCCCCTCCTTT
TTATCCATCCCTGTTCATAATCCCCAACTCAGAAGGCATTTTCCAGGTCAGGAATGGGATCGATTTTCAACATTGAGGTTTGGGGTGGGCCATAGACAGGCCAGCACCGTGGAGTCAGTC
CCAACCTTCAGTTTTGGAAAGGTCAAAGAAGATACAATTGGGCCCTGCCTCAAGAAGGCTAGTGGGGAGAACGTGGACTCCATGAATAACTCATCATAGCTGTGTCTTCTCTGCAGCACT
CTGGGGAAGGATAAATGGACTCAGAGAGAATAGGATGGGGATGGTCTAGAAAAGTTTTAGGGTGAGGTGTGATCATATCACATACAACCAGTCAGGACTTGCTGGCTAATGAAAGCCTGG
GCATGCCCATCTCTGCTCCCAAGTTCTTAGAGTTCAGATGTCTTAGCTCTGGGTTAGGACCCAACCACTCACCTTACCCCCAACCCCAGGGTAAAGAGATAGGGTTATGGGGCATGTGGA
GAATGGAATGGACGAAAGGTGACTCAGCCCCAGAGAGGTGTTTTCCTCCTACCAATTGAAAGGGAGATGCTAGGGAAGAGACCAGGTCCTCCTCTTCTTGCTGCGTCACCTCCCCAGTCC
AACTTCAGGCTGCCCACGCTCCTTGTCTCTACAAAAGGACTGCAGAAGCCGGAAAGAGTGACAACTGCTGACGTGCACGGGATCCTAGTAACTGCTGGTTTCTAGGTGACTAAACCTGGC
AGAGAGAATCATGGAACCACAGGCTGACAGAGTTAAAGGGCCCTTAAGACAGCCCTGAACCTGACTCCATCTTACAATGGAGGAGCTGGAGCCCCAGCAAAGGGGGTCACATGGCATCAG
AGACACAGCAAAGCCCAGCACTCAGGTCTCCTGACTCCCAGACCACTTCTCACAGCATCATATTGATAGGAGTAATAAGACGGGAGAGGAGAAAGACACAAGACCAGCAGCCCCAGCCAG
CCAGAGTCCTGGCTGAGTCCCATCATCCAACTCTCAAGCCATTGGAACCCTCTTCTCTTGCCCGGCTGTGGGAGGATTCAGGCACCCTCATGGCCTCTCCCCTTATCTCCTCTGGCCACT
GTTTCAGATGCGGTGCTCTGGGATTCCACGTGCCCAGAGAAGGGAAGGGGGCTCATAGAGGACTGAGTTGCAGTGATCAGTGGTGAGCACAGCCGTGGCTCTCCACCCATGGGCCACCTT
CTGACCCCCACTATCCCTTGACATGAGATTTCGTTCCAAGAGACTCCAGGCCTGTTTTGCTCTGCCAGCAGATTCCCACAACCATTTTGGGCAGCAGCATGCTTATCTCCCTGGACATAT
GCCCAGACAGTGTAAGTGACTTGCTCAGGGCCACACAGCCAGCAAAAAATAGAACCTAATGAAATAGGGTTCTCCTTGCCACACCCCCAAGCTGAAACTGTGCCCAGAAGCTGGTCCTTC
TGTTTACAAGTTCCCATTATTAGGACAACCTGTAATCTTTTTTTCCTCCATGTCTCAGAGTTCATTTTTGGATCATGGCAGAGTTAAAAAAGTGGAGAGGCTATAGACATGCCTGGCTTT
CTGGCCACTAGATCTTTGTGGCGGTCTAGGGTGTATTTGTTGTGCCCCAGTTTGTCTGCATTTTAAGGCGGAACTGGCCCTGGCTGGGAACGAGGAGGTCCAGGAGCAGTAGGAATGTTG
ATCTTAGGTCTTGGGCCTGCCTCCAGCACCCACCAAAAGTCACCGGATGTGGAATATTAGACTCATGTAAAGCAGGAAGTTTGCACCAGAGCCAAGAAGAGAGCTTGCAGCTGCCAGGGA
ATGGCCTGGCGGAGGAAGCGCAGCCTCGCCCAGCTCAGCAGACCTGCTTCATGACAGAGGCAGCTCTTCTGCACTCTACTGGGGCCACGCCCTGCCAGCATATATCACTCCCTTCACCTG
GTCAGGCCCAGGTACCTTGCCTCAACAGCAAGTTCTCCAGAATTGAGGGGAAGAGAGGGAGTGAATTTGCTTCTCTAACTCCAGCCACCTGTCTCTGCCCTCTCCTGGTCTATAATGCTA
CTTTGCATTCCATTTGTTTATTGTCTGCCCACCTCTCAAAGGATATCAGGGCCACAAAGGACCTTAAAGACCACCTTATACAATGGTTTCAAGGTTTCTCCTTTCCCATCACGACCAGCC
CACCTGCCAAATTGTGTCAATGATGCAATGACATCCTTTCAAGAATAGTCTCAGAATTTTGTTGTCTGTGTCACGGGCAGAGTAGGCTCATAGGCCACATCCTACTAGCCAGCAGTGACC
CCAATCCCCTCTCTCCCACTGATCATGATCCTATCAAGCCATCATGGTTGACCTGGTTGGAGAGTTGGTTCAGTTCAAGGTTCTCATTTTATAAATGAGGAAACTCAGGTCCGAAGAAAA
GAAAGGGCCAGTCCAAGACCACACAGGGAGTTAATGGCAAAGGGACATGGAGCCCAGGTCTCCCAGCCCACAGTCCACTGCACTCTGTCCCTCCTTGTCCTGGAGGCTGACTGTGAGCAG
CAGCTGGGGAGGGAGGAAGGCATAAGGGTCATCACCAGCCTGCTCAGACCCGGAACATTAACACATGCAGGTACTGTTGCTTTTCCCTACCTCACCACAGCCCTTTCCCCCATGCCTGGC
TCTCAGTCCTGCTTCCCTATTTGGTAACAACAGCTTCATCTTTCCTGTCCTGCAGATTGGGAGCCTCTGAATCACCATGTCCATACGGCCTCTTCCTCCTTTCTGTTCAGTTTTTCCTTC
ACACTGGCCTAGTTCAGGTTCTCATCCTCAATTGCCTGGATTATTCCAACAGCCACCCAACCAGTCTCCATCAGCCCGTCTAGGAACCCAGTCATCAGCTTTAGGGCAGTCTCCCTGAGA
GCCCAGTAAATGTTCTGAAATTGACATGTGATGTGGAAGTAATTAGCAAAATAAGTCATTCTCCAGGGTTCCATAGCACTCACTTATTAAGTGCTTAATATTAATAAGTGCTTATTAGGT
GCTTAATATTAATAAGTGCTTTTTAAGCACTTAATATTAAGTACCCGAAAAGCACTTATTAAGTGCTTTCATAATCATTATCTTAAACAAGGAATTAGGAGACGTCAGTGCTAGTCCAGT
TCCAATTCTCGGTGATTACTTTGAGAAAGTCACTCTCTCTGTTGGGATCTTTCATTCTTTTGAAAACGGAGATGTCCAAGTTCCTTTCCAGCTCTAACTGCTCCTTTTATGGCCTGTGTT
CCAGATGGACTGCCATGGTGGCATAAGTGGCACCATTTACGAGTACGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAA
CGTGGCCAGCTACTGAGGCCTGACGGGCCAGTACATTG
GTAAGAGCCCACCCTTCCTCCCTGCTTTATTTGGGGCTGTATGGCATATTTCAATCACAGGAGCTTTTCTGGTGCATGGGGG
AAAGGGTGATGGCAATCACGAGAGTCCAAGCCCCTTTTCTCAGCTCCACTGTGTTCCGTGGTTTTGTGAAGATGATTATATAAGCCTGAGGTCTGATTGCCTTTGGACATGTTCTAGGAG
ATTCCTAGTTATCCTTCTTCATCTCTGGGCACCTCAACAACCCTAAAGGCAGAGGGATAGAGATTAGGTTTGTGCTTAGAGCTCCCTTTGGCTGGAGCATGAGATGGTAACTGAAGCTCC
ATCTTGCTGAGAATATCTTATTTTCCCTCAGCCCCATCTGCTTTGGTGCTTCTCTTGGCAGCTCTCTGGAAAGCAGGCAATTGCCTCGAGGCCCCAGAGTGTATGCGTGGTGTAGCGGGA
TGAAGGAGCAGGCTACACTTCTAATGCCCATTCTAAAATAAACTTTGAAGATGATCTAGTTTAGCCTTCCCCTCTTCTCAATCTACACATGGGAAACCAAGACTCAGAGCGAAGATACAA
CTTAAACAGGGTCACAAAGCTATTAGCGGTGGAATGGGGCATTTGGCGCAGGTTTCATGATCTCCTGATATGCTTACTCCTTTCTCCCTAGCTGGGGTAGAATACAGAGGCTAGGGGAAC
AGGCAACCAAAGGCAAGCGACAGCACCCAGGGGAAAACGCTTTGGGGCTGAGCAGTCTACTGGCAGGGGGTCAGGGAGGCAAGGGCAATTTGACCCTCCATGCTCTGCCTGGCAATCACA
GGCGAATTCCCGGAAGTGAAAGGACGGCGGTCACGTGGCCCAGTGGCTGTGAGTGCTTTTTCTGGGATGCTTCTCTCTAGCCTTGGAACAGAGCAGAGTGCGTTTGGGCAAGAGATGGGC
TGGGTGCTGCTGCAAAAGAGACCAGGGGACACTGAGGAAACTGGGGAGCTGGGCCAGGGCCTCATCTGTGTTCCTGATTTGCCAAAGATTATGGGAGGGTTGTAACCTCACCCCAAAGAA
GTTCTCTGCCTTGTATCCAGGGATGGATAGTTCTTGCTCCAGAAAACTCAATCCTGAGGGTTCTGAATGAGTGCTCTAGCTGGCCCAGGTGGAGGGCCTTGGCAATGGGCAGGTGACTGA
CAGCTGACTTGAGGAAGGGTATTATTCTTGTCCTCCAAACCTCCAATCCATCCAGATTAGAGTCAAGAGGATAGGACCTGAGTCCCAGCATTGCTGTGAACTCACTGGTGATCCTGCGCA
AGTCCCTCCCTTTCTCGGGCCTCAGTAGTTCCAGCGGCACAGCGGGTGAGCCGGGGGAGTGGTGTGGATGAGACAGGGCTCCTCGCCAGGATACTCCCACATCTGCTCTTTCTCTTTGGC
CCAGAACTGAATGCACTACAGGAAGAGCTTGCACCATTCGGTCTGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCCTACCCTC
AA
GTGAGTACTCACTCAGCATCCTGAGAAAGCTCCTCTCACATGGCCCACATCTTGTTATCAACCCCAAATCATGGTGGACATTTATCGGCCACCAAGAACTACTCTCCTCTTCTAGGAT
CCCCAGTGGAATGAGGGAAGGGAAGGGACAAGAGAGGGAGAAGGACAGGGACAACTGGTTGTGATGTGCATCCGCAGGGAGCACCAAGGTTGAGGGACACTGAAAAGGGACCAGGCTAGA
AAGGAAGACCGTGGACTCACATTATGCCTATGCCCACTGCACATTCACTGGCTCCTGCTGCCCACTGCAGAATAAATCCAGACTCCCAACACCCTCTCCCCTGTTCTGTCCCTTCCTCTC
ATTTCTGAGCCCTGTGCCCACCTCCTTGGGACCCACCTAAGAACATTTCTCAACAGGTATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTCAAT
GGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAG
GTAAGTGAGCTGCCACCTGTGCTGGCTGGGGCTGCAGCCCCTCCTGGCTCCAGCCCACAGCGTCAGGGCCCATGCCACCTCCCC
TGCTCCTGGGCTCTTGGGGAATTTCTTGGCACCTGACTATTGTTCCAACTAGAGGGCTCTGCAGACCCTGACTAGGGTCTCATTGGCCCATTTTACAGAAAGGCCCAGAAGGACCCAGAG
TGAACATACTAAGGGTCTCACAATCTTCTAGAGCCACAGCTGGCGCTGGCAGTCTTCTAACTCCCAAACTGGGGCTCTTTTCTCAGGGCCAGGCTATTCCCCAGGAAGGCCTGGGAAGGA
AGAGGGTCAGGGGGCCTCAAGCAAGGTTGACACTCCTCTTATCCCTGCTCTAGAACTCCTGTCCTCCCACCTCGGAGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGG
TTCACGACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCACCGGACCACGGTCAGCAACGTCAAGATGGACATCCTGTCCTACATGA
GGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGCCCGGCTGCTGCAGGCGTCCTGCCTGCTTTCCCTGCTCCTGGCCGGCTTCGTCTCGCAGAGCCGGGGACAAGAGAAGTCGAAGATGGACTGCCATGGTGGCATAAGTGGCACCATTT
ACGAGTACGGAGCCCTCACCATTGATGGGGAGGAGTACATCCCCTTCAAGCAGTATGCTGGCAAATACGTCCTCTTTGTCAACGTGGCCAGCTACTGAGGCCTGACGGGCCAGTACATTG
AACTGAATGCACTACAGGAAGAGCTTGCACCATTCGGTCTGGTCATTCTGGGCTTTCCCTGCAACCAATTTGGAAAACAGGAACCAGGAGAGAACTCAGAGATCCTTCCTACCCTCAAGT
ATGTCCGACCAGGTGGAGGCTTTGTCCCTAATTTCCAGCTCTTTGAGAAAGGGGATGTCAATGGAGAGAAAGAGCAGAAATTCTACACTTTCCTAAAG
AACTCCTGTCCTCCCACCTCGG
AGCTCCTGGGTACATCTGACCGCCTCTTCTGGGAACCCATGAAGGTTCACGACATCCGCTGGAACTTTGAGAAGTTCCTGGTGGGGCCAGATGGTATACCCATCATGCGCTGGCACCACC
GGACCACGGTCAGCAACGTCAAGATGGACATCCTGTCCTACATGAGGCGGCAGGCAGCCCTGGGGGTCAAGAGGAAG

Retrieve as FASTA