Entry information : HsGPx04-A
Entry ID 3603
Creation 2007-02-08 (Marcia Pinheiro Margis)
Last sequence changes 2016-06-28 (Harold Duruflé)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-06-29 (Christophe Dunand)
Peroxidase information: HsGPx04-A
Name HsGPx04-A
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation Mitochondria
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsGPx04-A
start..stop
S start..stop
PtroGPx04 413 2.64e-150 1..197 1..197
PpyGPx04-A 413 2.64e-150 1..197 1..197
MnemGPx04 412 1.34e-149 1..197 1..197
MmulGPx04 412 1.34e-149 1..197 1..197
Gene structure Fichier Exons


exon

Literature and cross-references HsGPx04-A
Literature Esworthy R.S., Doan K., Doroshow J.H., Chu F.-F. Cloning and sequencing of the cDNA encoding a human testis phospholipid hydroperoxide glutathione peroxidase. Gene 144:317-318(1994).
Protein ref. UniProtKB:   P36969
DNA ref. GenBank:   AF060972.1
Cluster/Prediction ref. Genebank:   2879 UniGene:   Hs.433951
Protein sequence: HsGPx04-A
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   197 (172)
PWM (Da):   %s   21862.96 (19373.5)  
PI (pH):   %s   8.48 (8.05) Peptide Signal:   %s   cut: 26 range:26-197
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFLIDKNGCVVKRYGPMEEPLVIEKDLPHYF

Retrieve as FASTA  
Remarks Complete sequence from genomic (Chromo 19, 6 introns), 19 cDNA and 1048 ESTs. Three Alternative products produced by alternative splicing.
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST