Entry information : MtPrx36 (Medtr7g072510.1[4.0] / Medtr7g072510[3.5] / Medtr7g077890.1[3.0])
Entry ID 361
Creation 2005-09-13 (Christophe Dunand)
Last sequence changes 2010-09-16 (Haythem Mhadhbi)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-25 (Catherine Mathe)
Peroxidase information: MtPrx36 (Medtr7g072510.1[4.0] / Medtr7g072510[3.5] / Medtr7g077890.1[3.0])
Name (synonym) MtPrx36 (Medtr7g072510.1[4.0] / Medtr7g072510[3.5] / Medtr7g077890.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx012]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx36
start..stop
S start..stop
GmPrx188 495 1e-178 3..312 7..316
MtPrx33 491 4e-177 1..312 5..316
GmPrx52 488 8e-176 3..312 7..316
LjPrx10 469 2e-168 8..312 12..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 26959575..26959769 195 N° 2 26960874..26961065 192 N° 3 26961266..26961431 166 N° 4 26961662..26962047 386
join(26959575..26959769,26960874..26961065,26961266..26961431,26961662..26962047 )


exon

Literature and cross-references MtPrx36 (Medtr7g072510.1[4.0] / Medtr7g072510[3.5] / Medtr7g077890.1[3.0])
Literature Torres-Jerez,I. et al., unpublished
DNA ref. Phytozome 12:   chr7 (26959575..26962047)
Cluster/Prediction ref. Phytozome Gene 12:   31077256
Omic ref. Gene atlas:   Mtr.10372.1.S1_at Legoo:   Mtr.10372.1.S1_at
Protein sequence: MtPrx36 (Medtr7g072510.1[4.0] / Medtr7g072510[3.5] / Medtr7g077890.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   312 (294)
PWM (Da):   %s   32962.89 (31080.8)  
PI (pH):   %s   4.23 (4.18) Peptide Signal:   %s   cut: 19 range:19-312
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKIIIPIILCFVGIVSAQLSTDFYSTTCSDVLSTIKREIDSAVGNEARMGASILRLHFHDCFVQGCDASVLLDDTSSFTGEKTAGANANSLRGFDVIDTIKTELESLCPNTVSCADILSVAARDSVVALGGPSWTVQLGRRDSITASLSLANSDLPGPGSDLSGLITSFDNKGFTPKEMVALSGSHTIGQASCRFFRTRIYNDDNIDSSFATSLQANCPTTGGDDNLSPLDTTTPNTFDNSYFQNLQSQKGLFSSDQALFNGGSTDSDVDEYSSDSSSFATDFANAMVKMGNLNPITGSNGQIRTNCRVIN

Retrieve as FASTA  
Remarks Complete sequence from 24 ESTs and genomic (chromo 7, 3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAATTATTATTCCAATAATCTTATGCTTTGTTGGGATAGTTTCAGCTCAATTGTCCACTGATTTTTACTCAACAACGTGTTCTGATGTGCTTTCAACCATTAAAAGAGAAATA
GATTCTGCTGTTGGTAATGAGGCTCGTATGGGGGCATCAATACTTCGTCTTCATTTCCATGATTGTTTTGTTCAA
GCAAGTCTACTTTCACTTCTTAATTCTTCTATCTTTTCAATTTTT
TTGTTCATCAAAATTTCAACTATTATATATGGTCAATTGCATTAACTAAATATAAAAGTACACATACTCAAGTATGCTTGTATCACATATTTTACATTTATGCAAGAAATATTATATATG
ATCTATATGTGATAATATGATCTTTCAATCCATAAATTTTATAAAATACATATTTAGTAAAATGTTATTGAGCGGTGTAACATTACTCAATTGTTTTACCGATGTAATTTGATCTTCTTT
GTAAAGGAGTACTCAAATTACACTCAAAGAGTTGTGCTAATAGACTAATAGTTGCACTAATAACATCTTGTTGGATTAAACCCAACTATCAACATTTTTCTTTTCTCATTACTACTTAAT
TGATGAAATTTGTTTATTGAAAATTAAACAACTGCAGGTGAGTCAATGTGACAAGAGAAAAACATTAAGATTACACCCCCACACACGATTTTTTAATTGTTAATTTTTACTTTCCATTGC
TCATTTAAAGTTGTAAAATTATATTTTCTTATCTCTCAGAATATAAGTTAGAAAAAATCTCTAAATATTAGTTTCTTTTTATATTATTAGATTTTTTAACAAAAAAATGCTCCTAATTAA
TTTACTGCCTTTTTTAGAATCATTGTTTAACTAAAATTTGTTTATATATGACTTACTACTCTCTTCTTTATAGATTATATGACTTGCTACTCTAGTTAATTTATTAAATGAGATTGCTTA
TTTATCTTGTAAGGGCATGGCAAATTGGCAATCATGCGTATATTTCTTTATTTATTTTCTTAAAGAAGAACATTTCTTTCCTTTTTTTTTTGTGGGGGGGAATAACAACATTTCTTTCCT
TAAATAAAGAAAGAACATTTCCTAATTCATTATTATAATTTTGTAAAGGCGTGGCAATATAATTATATATACGTATGTTTTCTTAGAAGAATATTTCTTTCCTTGAATTAAAAAAAGAAC
ATTTCTTGATTAACAAGCAACAAAATGTCAACTAATGATATTATTATTATTTTTTTCAACAAAATCATTTTGGTCATCAATCTTGTGTTTTGAATATAGGGATGTGATGCATCAGTACTG
TTAGACGATACATCAAGTTTCACTGGTGAAAAAACAGCAGGTGCAAATGCTAATTCCTTAAGAGGTTTTGATGTAATTGACACTATAAAAACTGAACTGGAGAGTTTGTGCCCTAATACT
GTGTCATGCGCTGATATCCTTTCTGTAGCTGCAAGGGACTCTGTCGTCGCA
GTAAGTAATATTTGTTATCACAATGAGTTTGTCAGAATCATAGTGGTTCACTGTGACTATGACAACCTA
CTATGATACAAATCGTGCACTACGTATTTTCATATATATATACAACATAAAGCTATAGATCATTTAATAAAGCAATTTAATTAATTTGGATTAATACTAATTAATGTTGAAAATAATAAT
AAAAATTTCAGCTGGGTGGACCTAGTTGGACAGTGCAATTGGGCAGAAGGGATTCAATCACAGCAAGTTTAAGTTTAGCAAACTCAGATTTACCTGGTCCTGGTTCTGATCTAAGTGGTC
TTATAACTTCTTTTGATAACAAAGGTTTCACACCCAAAGAAATGGTTGCTTTATCAG
GTAACTATAGTTAGTACATTTCTAATCATTTTATATACTATTATTACTTTATTATAAACTTAT
CCTCCCAAAGTCAATTTCTGGGGCTAATTCGTATGGAGTTTTGCTTTGACTTTAAACGAGCCCCCACAATGAACAATGAGATTGATTCTCTCCAATTAGTCAGTCCTAAGGGTCGATTAT
TACTTTTACCATACGCTTTGACTCATACTTGCAAAACAATATTTTAGGATCTCACACAATTGGTCAAGCAAGTTGTAGATTCTTCAGAACCAGGATTTACAACGATGACAACATAGATTC
ATCATTTGCAACATCATTACAAGCAAATTGTCCTACCACAGGTGGTGATGACAATTTGTCACCACTTGACACCACTACTCCAAACACATTTGACAATTCTTATTTCCAGAACTTGCAAAG
CCAAAAGGGTCTCTTTTCTTCTGATCAAGCACTTTTCAATGGAGGATCCACAGACTCTGATGTTGATGAATATAGTAGTGACTCTTCAAGTTTTGCAACTGATTTTGCTAATGCAATGGT
CAAAATGGGGAATCTTAATCCAATTACTGGGTCTAATGGTCAGATTAGGACCAACTGCAGGGTAATCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAAATTATTATTCCAATAATCTTATGCTTTGTTGGGATAGTTTCAGCTCAATTGTCCACTGATTTTTACTCAACAACGTGTTCTGATGTGCTTTCAACCATTAAAAGAGAAATA
GATTCTGCTGTTGGTAATGAGGCTCGTATGGGGGCATCAATACTTCGTCTTCATTTCCATGATTGTTTTGTTCAA
GGATGTGATGCATCAGTACTGTTAGACGATACATCAAGTTTCACT
GGTGAAAAAACAGCAGGTGCAAATGCTAATTCCTTAAGAGGTTTTGATGTAATTGACACTATAAAAACTGAACTGGAGAGTTTGTGCCCTAATACTGTGTCATGCGCTGATATCCTTTCT
GTAGCTGCAAGGGACTCTGTCGTCGCA
CTGGGTGGACCTAGTTGGACAGTGCAATTGGGCAGAAGGGATTCAATCACAGCAAGTTTAAGTTTAGCAAACTCAGATTTACCTGGTCCTGGT
TCTGATCTAAGTGGTCTTATAACTTCTTTTGATAACAAAGGTTTCACACCCAAAGAAATGGTTGCTTTATCAG
GATCTCACACAATTGGTCAAGCAAGTTGTAGATTCTTCAGAACCAGG
ATTTACAACGATGACAACATAGATTCATCATTTGCAACATCATTACAAGCAAATTGTCCTACCACAGGTGGTGATGACAATTTGTCACCACTTGACACCACTACTCCAAACACATTTGAC
AATTCTTATTTCCAGAACTTGCAAAGCCAAAAGGGTCTCTTTTCTTCTGATCAAGCACTTTTCAATGGAGGATCCACAGACTCTGATGTTGATGAATATAGTAGTGACTCTTCAAGTTTT
GCAACTGATTTTGCTAATGCAATGGTCAAAATGGGGAATCTTAATCCAATTACTGGGTCTAATGGTCAGATTAGGACCAACTGCAGGGTAATCAATTGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GGACAAATAC ATAATCATAA GCATCTCCTA AAATTATACA AATTTTCATT ACCACAACCA TGGCTAAAAT TATTATTCCA ATAATCTTAT GCTTTGTTGG GATAGTTTCA GCTCAATTGT  CCACTGATTT TTACTCAACA ACGTGTTCTG ATGTGCTTTC AACCATTAAA AGAGAAATAG ATTCTGCTGT TGGTAATGAG GCTCGTATGG GGGCATCAAT ACTTCGTCTT CATTTCCATG  ATTGTTTTGT TCAAGGATGT GATGCATCAG TACTGTTAGA CGATACATCA AGTTTCACTG GTGAAAAAAC AGCAGGTGCA AATGCTAATT CCTTAAGAGG TTTTGATGTA ATTGACACTA  TAAAAACTGA ACTGGAGAGT TTGTGCCCTA ATACTGTGTC ATGCGCTGAT ATCCTTTCTG TAGCTGCAAG GGACTCTGTC GTCGCACTGG GTGGACCTAG TTGGACAGTG CAATTGGGCA  GAAGGGATTC AATCACAGCA AGTTTAAGTT TAGCAAACTC AGATTTACCT GGTCCTGGTT CTGATCTAAG TGGTCTTATA ACTTCTTTTG ATAACAAAGG TTTCACACCC AAAGAAATGG  TTGCTTTATC AGGATCTCAC ACAATTGGTC AAGCAAGTTG TAGATTCTTC AGAACCAGGA TTTACAACGA TGACAACATA GATTCATCAT TTGCAACATC ATTACAAGCA AATTGTCCTA  CCACAGGTGG TGATGACAAT TTGTCACCAC TTGACACCAC TACTCCAAAC ACATTTGACA ATTCTTATTT CCAGAACTTG CAAAGCCAAA AGGGTCTCTT TTCTTCTGAT CAAGCACTTT  TCAATGGAGG ATCCACAGAC TCTGATGTTG ATGAATATAG TAGTGACTCT TCAAGTTTTG CAACTGATTT TGCTAATGCA ATGGTCAAAA TGGGGAATCT TAATCCAATT ACTGGGTCTA  ATGGTCAGAT TAGGACCAAC TGCAGGGTAA TCAATTGAGT TTTGGGGCCT ATTGGGAACA TATAATGCAA GTTGATTATG GGTATTTTTC ATTTTTAAGG TGTGCAATTG TGTAATATTA 
TTGTGGCAAA GTCAAAGTTT CCATAAATGT AAGGTGTGTT TGAATTTTAA ATGGATTTAT GTCAATGTTT GCAACTGTTT T 

Retrieve as FASTA