Entry information : MtPrx37 ( Medtr3g072210.1[4.0] / Medtr3g072260+Medtr3g072210[3.5])
Entry ID 362
Creation 2006-09-06 (Christophe Dunand)
Last sequence changes 2016-04-12 (Catherine Mathe)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-13 (Christophe Dunand)
Peroxidase information: MtPrx37 ( Medtr3g072210.1[4.0] / Medtr3g072260+Medtr3g072210[3.5])
Name (synonym) MtPrx37 ( Medtr3g072210.1[4.0] / Medtr3g072260+Medtr3g072210[3.5])
Class Class III peroxidase    [Orthogroup: Prx040]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Leaves
Seedlings
Inducers Drought
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Pathogen interaction
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx37
start..stop
S start..stop
MtPrx34 585 0 1..320 1..318
GmPrx22 501 0 1..320 1..314
LjPrx15 478 8e-172 1..320 1..316
MePrx35 439 9e-157 1..320 1..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 32451067..32451279 213 N° 2 32450778..32450969 192 N° 3 32431124..32431289 166 N° 4 32430587..32430978 392
complement(join(32430587..32430978,32431124..32431289,32450778..32450969,3245106 7..32451279))


exon

Literature and cross-references MtPrx37 ( Medtr3g072210.1[4.0] / Medtr3g072260+Medtr3g072210[3.5])
Literature Korth,K. et al., unpublished, Torrez-Jerez,I. et al., unpublished.
DNA ref. Phytozome 12:   chr3 (32451279..32430587)
Cluster/Prediction ref. Phytozome Gene 12:   31061175 [Incorrect prediction]
Omic ref. Gene atlas:   Mtr.24540.1.S1_s_at   Mtr.46628.1.S1_s_at Legoo:   Mtr.24540.1.S1_s_at   Mtr.46628.1.S1_s_at
Protein sequence: MtPrx37 ( Medtr3g072210.1[4.0] / Medtr3g072260+Medtr3g072210[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (298)
PWM (Da):   %s   34903.52 (32448.3)  
PI (pH):   %s   7.15 (7.92) Peptide Signal:   %s   cut: 23 range:23-320
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAYYFLLIVLLAASEISEADGQNELCTDFYCNSCPELLSIVNQGVVNALKKETRIGASLLRLHFHDCFVNGCDASILLDDTSSFIGEKTAAANNNSARGFNVIDDIKASVEKACPKVVSCADILALAARDSVVHLGGPSWDVGLGRRDSITASRSDANNSIPAPFFNLSTLKTNFANQGLSVEDLVALSGAHTIGLARCVQFRAHIYNDSNVDPLFRKSLQNKCPRSGNDNVLEPFDYQTPTHFDNLYFKNLLAKKTLLHSDHELFNIGSSTNNLVRKYATNNAEFFKAFAEGMVKMSSSIKPLTGSNGQIRINCRKTN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 3 and 3 introns) and 12 ESTs (confirmed our prediction). Incorrect prediction from Phytozome: two separated accessions: Medtr3g072260 (5') and Medtr3g072210 (3'). Very long intron 2, probably due to an error of assembly.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTACTACTTCCTCTTAATTGTTCTTCTTGCAGCTTCTGAAATATCTGAAGCAGATGGCCAAAATGAGTTATGTACAGACTTTTACTGCAACAGCTGCCCGGAACTGTTGTCT
ATAGTGAACCAAGGAGTCGTAAATGCTCTTAAAAAAGAAACTCGAATAGGAGCTTCTTTACTTCGATTGCATTTCCATGACTGCTTTGTAAAT
GTGAGTGTATATGATATGATAAAATAC
ATTATTGACTTGATTTTAATCTTCTGTTTCACTTAACTTGGCTTCATTTAACCCAATGATGATCATTAAGGGCTGTGACGCATCGATTCTGTTGGATGATACAAGCAGTTTCATAGGAGA
GAAAACAGCAGCAGCTAACAATAATTCAGCTAGAGGATTCAACGTGATTGATGACATCAAAGCCAGTGTGGAGAAAGCATGCCCCAAGGTTGTGTCCTGTGCTGATATTCTTGCTCTGGC
TGCTCGAGACTCAGTTGTTCAT
GTAAGTTATGTTATAAATTTCACATCAAAATAATATAGTAGATGGTAACACATTTTAAATATATATGTGTTCAGGTAATAAATATAACAAGGTGTTAC
GACTCGTTAATTATCCATAAAACAAAACTAACCACGACTTTGATTGTCGTTATGTTATCATGGTTTTTGGGTGCCAAGCCATTAATTGGACTTGAACCTTTTGACCGTTGATATTCTCTA
TTTTTTCTTGGGAAGGGCAAAATTGAGAAAAACCCTTAGATTCTAAGTTCGGGGGTCGTTTTCGCTACGGGAAGGTGTTAGGCACCCGGAACGATTATGGTATTCCATAAGAGCCGTTCT
CCTAAGTTGATTTCTACGCTTTATTTTTTATTGCCTACTTGTAAAAAAAGAAGGTGTGATTAGTGAAGAATGGGGGTGAGAAGAAGTAGAATTTGATTTTATTTCGGCTTGGAGGGTTTA
AAGTCCCTTGCCTACGTACCGTTTTACGGGATCAAAACCGGCGTAGTTCTTGCTAAAAAGACTTGTGGTTTTTTGTTTTAATTGTTTGATTTTAAATTTTGAAAATGATTTGAAGAAGGG
GATTGAGAGGCTTCATGAGCATTAGAGTATGAAAAAGTGAGGGTTTGCTTAATGATTTTGCAAAAGAAGTCTTAATGATTAGGTTTATTTGAGAATTTGATTAAAAAAAAAAAAGGGAAA
AATTATTGGAGTTTTGACTCCATTTCTTATGAAAAAAAATATTTGAAGTGAATTTGTTTGCATATTTTTTGGAAAAAAGTTGGATTTTCTCTAAGTGTTTAAACCTAAGCATTCATCTAA
CCATGCAATCATAGGCATACATCTAGGGTGAGTGTGTGCGTGCCGGTGCGCCATAGTGTCCATAGTCCATATTACAAAAATTGCCTAAATACATTCTATGGCCCCTTTGCCAAGCTACAT
ACCAATGATAGCAAATTACATCACCAAATGAATTAAAATTTGCAAAAATAAATGCTAAGCTGAAGAAAGTGGAGGAGATAGTGGTGAAATGGAGAAATGCTCATGAAATGAATGGAACAA
AAGAAGTGAGATGATTAGTAAAATAAAGCATAGAATAAAAGAAGTGCACAAAAATATTAAGAGGAAAGACATAAAAGAAACTAATAAAGTGACAAAATGTGCATGAAAATGGTCATAAGG
CTCTAGCATATATATGACCCATAATCCCTTCATTATGACATTTTTAGAAGTCTTGCTTTGTGCCCTAATGTGAAAAAAAATGGGACATATTTGATGCTAAGTTTATGGTACACTTTCAAA
ATATTTTGGCACTTTATTTACTAGTAAAAATGCATACTAATTGCAGAACAAAAAGGGAGATGAAATTGAGATACACAAGCAGCAAATTAAACATGTAATCAGCAACAAACTTATCACAAA
ATTGCATTCCCAAAAATTCATATCACATGCCAACATTTCATGAGAAATACACTACTAAAAAATGCACAAATTTTTGTCTAATACACTAATTACCCAAGAAATATCACATGCTTTTTTTTT
TTTTTATCATTTTAAAACCATTGAGAAATATAAAAAAAAAAAGGAAAATACATCAAGAAACATGTGATAATTTTTGGAGATTTTTTTTAGAGAAAATTTAAGCATGCAGGGGTTCAAACA
GCAAAGAAACATGGTGCAAATAGCAGGAAAATAAGCAAAAGCGCGCAAGAAGCCTAAGCCCAACCCAAAGCCCAACACACAAAACTCAGATTGCACAGGAGACGTTGGATTGATCCAGGG
TAGGAAACCCTAGATCCAACGGCCAGGAATGAAGGAGATTGGACCGGTCCTGGACCGGTCCGGTTCACTGGCTATATAAACACATTAGCGCCGGTTTTTTTTATTTTACACTCTTCTTTC
TCTCTCTAAACTCTTCTCTCTTCTCTCACCTCTCACCGGATTCTGGAAAAAATGGAAGATCTTCATCTTCCTCGGTGAGGCTTGTTCCTCCGGCGTGGTGGCCGGCCGCCCAAGGGTGGC
GGCGCCGCCGCCGGAGTTGAACGAACTTCACCGTTTTCAAAAAAACTTACGTTTTCAGATATCCTTTTTTATCCTAAACACGAATATGGCACTGGATTTTACATGCAAGGCGTGAATCAA
CGTAGATCTACGGTTTTGTGTTACGGTTTTGAGAAATTTTTCTTGATTCTTTTTAGTGTTTTGTTGAATGAGAGCTTTGGAACTTTACAGATCTGTAACTGATTCGTGCTTATGGATATT
TTTGAGAAAGAAAGGCGAGTTTTACGTATTTTACCTGCGGTTTCAAACGGAGATTTCGAATCGGAATCTTTGAGAAACTTGAATTCTGGTGCTGTTTGTTGATTTTTTGTTCTTGAATCC
GAAAATGAACCGTTGTTTTCCTACTGGTTTGCTTTCTTTATCTCCTTCACCGGTTTGGATCTCTGATTCTTTCCCTCTTCTTCTTCGCTTTGATCTCTGTGATCGGTGCTTGAGTCCGCC
GTCAACAATGGCGGATTCGCGCCTAGAATTGCAGAAGCAAAGGTTCAATGATGATGATTACGCGCGAATCTCTGAGAACCGTGAGAAAATCCAAGAAAAAACGGTTGAATTTGGATGAGT
TCTGGCGAATTTCTGAACTAGGGTTCGTGATTTTTTCTTTGTTCTTGCTGATTTCTCTGTGATTTTGGTTTTGATCTAACTGACAAGAGAGAGAAAAATTGATTCTGTTTTTTGGTGAAG
TGGCGTGTGGTTAATGGGTCTGTGTGGCACTGTACACCTTTTATAGCTGACATGTGTGATCTTGGACCAATAGAATTGTGACATCTGGACTTTAACTGAAAGAAACGTGAGTTTGACACT
TTGAGCCCTTTTCTGCAAAATTGAAAAATTAAAGGACTAAAATGGAAATAACAAAAAGGACTAAAAATGCAAATAGAAAGAATTCTGGACTGAAATGCAATTTTAAAAAAAAGAGTTCTG
GACTGAAAAGCAATTTTGGACCTCTTTGAGGACCAAAATGCAAAATAAAAAATAAAATTGAAATAAAATTGGTAACCTGACAAAACGTAAAGCGAAACAAAAATAAAATTGACAAAACGG
ACTAAAACGAACCAATGGTTTAAATGAGGTACTTCAAAGTAACCTCTCTATGCTAAAATTTTGTGTGAAATGACCAAAATGCCCCTAGGGCTAAAATGACCTAAACAGATTCAAATTGAC
TTGACACTGACTCAGATGCAAGTTTGAAATGAATTTAACAAGGTTTACTGATGCAATGTTAAAAATCAATCTGAAAAGACTCAGAGACAGTCACAGGGATGAAAATGGGTCCCACTGCAG
GAAACGACCAAAATACCCTTCTGTACGACTTTTTGCAAATTTTGAAATAAACTGTAGAAAAAGCAATGTAATGATTCAGAGACACTTTTGAATGACTTACAAGACAAGTAAAGACATTTC
AAAAAGTTTTATGCAAGAAAAACATAGGTAAAATTGTGATTGAAAATACTGCGAGGCAGAGACAATTTGAACTGTGCAGTTGAAATTTGATAATTGACAAAGTTTGAAATGAAACTGGGC
CTAGTATTTTTAGGTCCAAAAACAGGGTATAACAGCTGCCCCTATTTAAGTTTCTTTGTCTGGAGAGTCAAGAGACGGAGTCTTTGGCTTGACAGGACGAAGATACTTAAATATTAGCAT
TTGCACTGTGTTTGGACGTAAAAATACGCCTACCCATTTTCAAATAATATGCATGCCATGCACCATTTGGATTATGAATGCAAGACCTCATGGAGATTAAAATATGTCGTATCCATTGCG
GGATTGGTAGACATTGACAAAGATAATGAATAGCAGAGTAACGGGGAACTAGAAACAAGTTGGACAGGTACAAGCTGTTCTTGGATTTAAACTAGCCACTTGACCAGGAATGAAACGAAC
AGACAACTGCGAGTTGTTCTTATGGATTCGAACTGGTAACTTCACAGGGGATAGAGGTTACTGGACAAACATGAGTTGTTCTTATGGATTCGAACTGGTAACTCACTTGGGGATGTTGGA
AAGTGCGAGTTGTTCTTATGGATTCGAACTGGTGACTCGACTGGGAAAAAGAGAAAATTGGCAAGTACGAGTTGTTCTTATGGATTCGAACTGGTTACTCGACTGAAAGCAAGGCAAATA
GACAGGTGCGAGCTTGTTCTTGGATGCGAACTGGTTACTCCACCGGAGACAAACACAAAATAGACAGGCGCAAGCTGCTCTTGGATCGAGCTAGCCACTTGAGCGAATAGAAACAGATAG
ACGGGTACAAGCTGCTCTTGGATCGAGCTAGCCACTTGAGCGAATAGAAACAGATAGACGGGTACAAGCTGTTCTTGGATTCGAACTGGTAACTCGACCGACAGCATTGAAAAGTAAACG
GGTACAAGTCGTTCTTGGATGCGAACCGGTAACTTGACCAAACAGAAACATATTGACAGGTACAAGCTGCTCTTGGATTGAGCTGGGCACTTGACCGAACAGAAACAAATTCACAGGGGA
TTAGTTTTTTTTTTGACAAAATATAGGTTGAAATTGACTTGACGTTGATTTGATTTGAAAGGTAGAAATCGACCGATACTAATGGCTCACAAGGTTTTGATAGAGAACCTGACATGAGTA
TTGAATTGAGACTGATGTTGACATTGGAAATGCAATATGCATAGATGACATAACAGTTTTATTAAATGCGTGGGCACGTAATATGCATGATTATGCATGTATGAATGCTTGTAATGCATG
ACTGTTGGCATTTTGTAGGCACGACTTCACGGGGAAGACAAGACATCAGAGTATTGGGCACGTAGTGGCTCGTGCTATGTTACACATTCTTGGAAATCCTCTTTGGTGATGACGTCGTTG
GGAGACGTGTCGGAACCATGGCTGAGGGCAGGTAGCTATGCAACTTGCTGGGGATAGAATCTTGGGAGACTCTACTGGGAATAATGCCGGCTGTACCGTGGGCGTCGCATCTATGGTCAA
TGCTTTTTTTGCATGTTATTTTCTCAACTTTCATTCATCATTTTTTTGCATCCCATTTTTGTCTGGATCGCCCTTTCGGGTTTTCGATCCACCGGGGAAATAAATTCTTTTCAATGCCCC
ATTTTTGCCTGAACTGCCCTTTCGGGTTGTCAATCCAGCGGGTTGCTCATTTTTGCCTAAGTCGCCCTTTCGGGTTTTCAACTTAGCGAGCCTATTCATTTTCATGCATTTTCATTCTGT
TTTTTTTTTCATTCTTGCCATTGACCACAGACTATCCTGGAGGAGAACCTGCTTGTAACATATATTGAAATAGACACCAACACACACTCGCTCATGCATGTTCATTTGAATGTACCCTGT
TGCTCAGGTTTGCTTTTCAAAAAACTTTTTCAATTTTCAAAATGTTTGTTTCGAGCATTATCATTATCAAAACAGAAAGAAAATGTTTTGTATATAACTTTGAAAGTAAAAAGAAAGCAG
AGTTTCAAACAAAAGCACAAGCTCAAATTGATGTATAAGAGTGGTGGTCAGCCGAAGGCGTGACTCCACGGATTTACAAAGCTTGGAAAATGGTAATTTTATTGGTTGGTGGTACATTGA
ACACAGTAATCATGACATTTCCCAGAAACTTTGAATTCGCGAGCATAAGAGCTTTTGATGAAGACGGTCATTAACAGCTGCAGATGCCCCAAGGGGGACGGTGGTTGGCCAGATATAGTT
ACTTGCCTTTTGTTTCAATCTCATTTTTGCATGAACCGCCCTTCCGGGTTTTCGATTCATCGAGACGCTCATTCTTGCCTGAGTTGCGTGCAATCTCAGCGAGCTTTTTCATATATATAT
ATATTTTTTGTCCCTTATTTTTGCCTGGACCGCCCTTTCGGGTTTTCGATCCACCGGGAAGCGCATTTTTGCCTAGGCCGCCCTTTCGGGTTTTCGACCTACCACGCTGTTCTTTTCATA
TTTCTAGGCAAAGTATTTCTTGACTATATCGGCATTCACTGGATTTGGAAGTTCTACACCATCCATGTGTGTAAGGATTAAAGCACCATCGGAGAAGGCCTTCTTGACAACATAAGGACC
TTCATAGTTAGGCGTCCACTTGCCCCTTGGGTCGGGTTGCTGGCTTACCCTCCTTTTCAATACAAGTTCCCCTACCTTGAATTCTCGAGGACGGACTTTCTTGTCAAAAGCGGTCTTCAT
TCTTGCTTGATATGACTGTCCACGAGCCATGGCATCCATACGTTTTTCCTCAATCAAATTCAACTGATCATACCGGGTTTGGCACCATTCAGCCTCAGATAACTTTGCTTCCATGATCAC
ACGGAGGGATGGGATCTCCACTTCCAAAGGAAGAACTGCTTCCATACCATATACAAGAGAGAAAGGGGTTGCCCCGGTTGAACTGCGCACAGTGGTACGGTAGCCATGCAGAGCATAGGG
TAACATCTCATGCCAGTCCTTGTAAGTGGTTACCATCTTCTGGACAATTCTCTTGATATTCTTGTTGGCGGCCTCAACTGCACCATTCATCTGAGGTCTATAAGGAGAAGAGTTATGATG
CTCAATTTTGAATTCTTCACAAAGAGCTTGCACCACATTGTTATTCAGGTTGGTACCATTGTCGGTAATAATCTTGCTGGGAACACCATATCGACAGATGATGTTGTTCTTGATGAACTT
AGCTACCACTTGCTTGGTCACATTGGTATAAGATGCTGCTTCAACCCACTTGGTGAAGTAGTCAATTGCCACTAAGATGAAACGATGACCATTTGAAGCCTTCGGTTCAATTCTTCCAAT
CATGTCGATGCCCCACATTGAGAACGGCCATGGGGATGAAATAACATTGAGAGCGTGCGGAGGCACATGAATCTTATCAGCATAGATTTGACATTTGTGGCACTTTCTGGCGTGCTGGTA
GCAATCATGCTCCATGGCCATCCAGTAGTAACCTGCCCGTAACAACTTCCTTGACATAGTATGCCCTGTAGCATGGGTCCCAAAGGTACCGTCATGTACATCATGCATTAACTGCTCTGC
TTCGTGTTCATCAACACATCTTAACAATACCATGTCATAGTTTCTCTTGTACAGAATATCTCCATCTAACAGGAATCTACTGGCCAATCTTCTCAGGGTCTTCTTATCTTGTTTGGAAGC
ACCCGGCGGATACTCACGGCTCAGCAAGAACTGTTTGATGTCGTAGTACCAGGGTTTATAGTCAACCACATTTTCACCAGCCTGATCGATCACATCCCCAATAGCAAACACATGTGAAGG
TCTTTCAAGGTGTTGCACTTTGATTATTGGCACATCATTCCAATGGTTTACTCGAAACATGGAGGATAGAGTAGCAAGAGCATCAGCCATTTGGTTCTCATCACGAGGAATATGGTGCAG
CTCAACCTTTGTAAAATATGTCAGCAGACGTCTCGCATAATCACGATAAGGAATCAACTTAGCATGGTGGGTCTCCCATTCACCCTTTATCTGATTGATGACGAGCGCAGAATCTCCATA
GATGTCGAGGTGTTTGATTCTCATGTCAATTGCTTCCTCGATCCCAAAGATACATGCTTCATACTCAGCCATATTGTTTGTACATTCGAACAGAATTCTGGCGGTAAAAGGGATGTGATG
CCCCTGTGGGGATACAATGACTGCCCCAATTCCTTTACCATAAGCATTGACAGCACCATCAAAGACTAAACCCCACTTGCTATTGGGATCTGGACCTTCATTAATCAACGGTTCTTCGCA
GTCTTTTGATTTCAAATACATGATTTCTTCATCGGGGAAGTCGAATTCAATTGGTTGATAATCGTCAAGAGGTTGGTAAGCAAGGTGATCGGCAAGAATGCTACCTTTGATTGCCTTTTG
AGTTTTGAACACAATATCATATTCAGACAAAAGCATCTGCCATCGTGCAATCTTCCCAGTAACAGCAGCTTTCTCAAAGATATACTTTATCGGATCCATTCTGGATATCAACCAAGTTGT
ATGATTCACCAAATAATGACGCAGGCGTTTAGCGGCCCAGGCCAAAGCACAACAAGTCTTCTCAAGCATTGTATACCGAGTTTCACAATCGGTGAACTTCTTGCTTAGATAGTAGATAGC
ATGTTCTTTCTTTCCAGTCTCATCTTGTTGACCAAGTACGCATCCCATGGATTCATCAAATACTGCCAAATACATAATCAAAGGCCTTCCTTCCACGGGCGGGACAAGGATAGGTGGTTC
CAGCAGGTAATTCTTGATGCTATCAAAAGCTTCTTGGCATTCATCATTCCATACAACAGACTGATTCTTTCTGAGTAGCTTGAAGATCGGCCCGCAGGTTGCGGTCATGTGAGATATGAA
TCGGGAGATGTAATTCAAACGTCCGAGGAAACCTCTGACTTGCTTCTCGATCCGTGGAGCTGGCATTTCTCGGATGGCCCGGACTTTATCAGGATCGACTTCAATGCCCTTTTGGCTGAC
AATGAAGCCTAATAACTTCCCGGATCTGACGCCGAATATACATTTGTTGGGATTCAATCGAAGCTTGTATTTTCTTAACCTTTCAAACATCTTTGTCAAATACTCAACATGTTGCTCCTC
ATCTGTTGACTTTACAATCATATCATCCACATATACTTCGACTTCTTTGTGAATCATGTCATGAAACAGAGTAGTCATTCCTCTTTGGTAGGTAGCACCAGCATTTATTAGGCCGAACGG
CATCACTTTGTAGCAGAAAGTACCCCATGGAGTGATAAAAGACGTCTTTTCTCTATCTTCAGGAGACATTTTGATCTGATTGTAACCGGAGAAACCGTCCATGAAGGAAAACACCTTAGA
CTGAGCAGTATTATCAACAAGCACATCAATATGAGGTAATGGAAAGTTGTCTTTTGGACTGGCTTTGTTCAGGTCTCTGAAGTCAACACACATCCGGACTTTACCATCCTTCTTTGGCAC
AGGTACAATATTGGCAACCCATTCAGGGTACTCAACTGTCATGAGGAAACCCGCATCAATCTGTTTTTGAACCTCGCTCTTAATCTTGAGAGCCATGTCTGGATGAGTCCTTCTCAATTT
CTGCCTGACGGGAGGACATTCAGGCTTGGTGGGAATCCGATGCTCCACAATCATAGGATCTAGACCTGGCATATCTTCATACGACCATGCAAAAATGTCCGGATATTCCCGGAGGAGTTG
GATGATCTTCTTTTTAACCCATTCCTCTAGAGCAGCACCGATCTTGATTTCTCGCTTGTTCTCCTCGGTACCTATGTTGATAAGCTCAATCTCTTCCTGGTGAGGCTGAATGGCTTTCTT
TTCTTGCTCAAGTAACCGAGTGATCTCATATGGTACGTCATCACCTTCCTCATCTTCGGCCTCATACACTGGGAACTCGAAATTCGGAGGGAATGCAGGGTTACTGTGCCCAACGGGTTT
ATTATAGTTCAATCTGCGTAAAATGGTTGGATGATTTTAGAAAGAGGGTTTTTATGCAGATTTTTGAAATTAATAAGAAAAATACAGATGTTTTGGTTTTTTCTGGCATTACCATTATTT
CCAAGGGAAAAAAGGCACTAAAAAAGCAGTCGTGAAAGAAACGACAATTTTTATTAATCAACGGCAATGCCGAAACAAACATGCCCTTACAGAAAATATCACTCTCGCTTTGGGCAGAGC
GAGAGGATTGTTATTTTGAAAAAACAAGATACTTAAGCAACAAGGTATATTACTCAGAAACATGCATGATTGAGGGAATGTCAATGGCATCCCAATCTCTCGCAAAGCCTCCTGGTGTAA
CAAATACAGGCCTCGGGCCAAATCCAGTTGCTTCTTCTGTGATTGCGTTGACAAACCCAGCACTACAGAATGCCCCGGTGGAAACTCCTGAAGTTGGGGAAAAGCCAAGACCTTCCTTAT
GCTTGTTCTCACGAAGCTGTATTAACTTGCCCCAGCCGGCAGCTTGACCCTCTTGGACGGCTCTCTGTGCATCCTTCAAAGAAGCCATGGCAGTTCCATCCCTCTTGGGCTCCGTACCTT
CGACAGTTAATCCTTGAAAAGCGGTCCCCTCTGCCGACCCTGCCTCTATGCAAGAGAAAGATGATAGCTGGCTAACCAGGTATGCCTCTTCTCCATGAATGGTAACAAGCTTTCCACTTC
TTATGAACTTCAACTTCTGATGTAAGGTGGAGGTTACCACACCCGCATCGTGTATCCACGGTCTTCCCAGCAGACAACTGTAGGATGCATTAATGTCCATCACTTGGAAGGTAATCAAGA
AATTCTCAGGGCCAATGGTTATCGGTAAGTCTATCTCCCCCAGCACATTCTTTCGAGATCCGTCAAAAGCTTTGACCAAGAAAGTACTCCTCCTCAAAGGGGTCCCTCGGTAGCTCAACT
GATCTAGAGTTGACTTGGGCATTACATTGAGGGAGGAACCGGTATCCACTAACACATTTGATATCATGTCTGATTTGCAATTCACCGAGATGTGCAAAGCCAGATTGTGACTCTTTCCCA
CTTCCGGCAACTCTTCTTCACTAAACTAGAGGTTGTTACAAGCAGTAATATTTCCCACTATGCCACCGAAACGATCTACCGTGACCTCGTGGTCAACATAAGCCTGCTCCAACACTTTCA
ACAAGGTATTCCTGTGAGCCTCAGAGCTCAAGAGTAACGACAAGACATATATCTTTGAAGGAGTTTGCAGCAATTGATCAACGATCTTGTAGTCGCTCCTCTTTATTATCCTCAGAATCT
CATCTAAATTCGAATCCTCTATAGATTTGCCTGGCTGGTTCACATCTATAGCAATGGGTGAAACAACGGTTGGAGTTGCTTCTTCAACTGGTGGAGTGGTTGGCGTAGCTACCTTCTTCT
GAAATAACGGCGGACGGACCTTCCCGCTTCTTAGCGCTGCAGAAGTCCCTTCGGCAATATTGCTTACTGTGGCAAAGGAGGCTAGAGGCACCTCTACTCCATTTTCTATCATAGTAGCAT
TGTATTTGTATGGAACAGCCTTGTCCGAAACATAAGGAATTGGTCCTGGCAACCTTATCACCAACGGCTCAACGCTCTCCCTCAAAGGCACCCTCTTAACAGGCGGATCGTGAAAGACCG
GCACAATTACGCAAACATCACTGACAGTAAGGTAATTGCCGTCCATCAAGCTCTGGACATCGTTTTGGACGACATGGCAACCCAAAGGATTGCGGGAACATTCTTGGCACTCAGCATGAT
CATGTTCAAACAATAAAGCCTGGCACAACTTGATATGGAGTGGCACCAGAGGAGTTGCAACATTGCGGACATCCAGCATGGGAACCTCTTCACATATCTCAATCATATTCACGGCAGCAT
GATTTGGGAGCGGATTATCGAGGACATGTGGCACATTGTTCTCAAAAGTTAACTTCCCTTGATCTATAAGCTTCTTGACGATGTACTTTAGAGCATAGCACCCCTCAACATCATGCCCTA
AAGCGCCTTGATGGAAGTCACACTTAAGATCAGAGCGGAACCTTGGAGGTAAAGGGTCCGGTGGAGGCTTGCCCTGCCTAGTCGTGCAGTGTCCTCTCTGGAGTAAAGTTGGAAGAAGTT
CTGCATACAACATTGGTATAGGAGGAAAAGTTGGTCTAGCATATTGCTGCTGCTGCTGTTGAACTGGCGGTTGATGTTGCACCTGTTGAGCGATGGCATTGACAGGGACCTGAGGTTGGC
CCGGTGGCAAAGGGTACTGATGATAAAACGGTGGGAAGAACGGATGCTGAGAGTACGGTGCATAAGGGTAGGACGGGGGAAACTGAGCAGCATTGACAGGAGCAACAGTAGCCTTGGATG
GATTAGTTCCAGCGGCTATCATTCCCACCTCCGTATCTTTCTTCTTGTGATGTCCATTACCGTATCTCTTCGCAGCATTTGCAGATGACTCAATCTTCTCAAACACAATGATGCCTTCCC
GAACAGCTTCTTCCAGACGTGTTCCCATGGTAACCATCTCTGAGAAATTGTTTGGTGCTGCGATAATCATCCTTTCAACATAATCTCTCTTGAGAGTCTTCAGAAATGTCTGAGTCATTT
CTTCTTCATCTAAAGCAGGAGTGATACGGGCAGCTGCCCCTCTCCACCTTTGCGCATATTCACGGAAACTTTCCTCCTTCTTCTGAGACAGGGACCTGAGAAACTCCCTATTTGGCTTCA
ATCTTGTGTTGAACCCATAATGGCTTTTGAAAGCGGCTGCTAGCTCATCAAAAGTGTGGACATCATCTTTGCTCAGACTAGTATACCACTCTGCAGCATCCTCCATCAGACTGCCTTGGA
AGTAATGGATCATAAGGGAATCATTGTCCTTGTAGTTGCCCATTTTCCGGACATATTTGACAATATGATTTTGAGGACAAGTCAGCCCGTTATACTTGTCGAACTCCGGGACTTTGAACT
TTTTTGGAACATCTACCTTCGATACTAAGCAGAGATCCTGGGTTTTAATGGAGTCTCCGTTTCCCCTGTTGGCCTTAATTTCCCGTCGGAGCTCTTTGGCAAGTTCTTCCATTCTCTCTT
CCATAGTTTCGGTTGCGGCAATACTCCCGTGGTGCGCATTAACATGGACAAATTGAGGCACCGTATTCACAATGGGCTCGGTAACAGTTGTTGCGGCTTGAGTCAAGGCGGTACTAACAG
GAGTCAAGTTTGCCCCTGAAATTGGGCCATTGTTGGTAGTACCAGAGGTGCCTGCCCCTGTATTAGCAGTATAGTACGGCGGAAGTCCGTAAGGATACCCAGATGGCATGATAAAGCGGG
GATCAGTTGTTACGGTAGGAGTCACATTTGCAGCTGCAGAAACTACAGGAGTTGGTTGTTCTTGAGCAGCCAACAGAGCAGTCATAGCATCATGAGCTTTGGCCAATTCCTCCCTTAGAG
ATGCCAATTCGGTACGGAGCTGCGTGTTCTCTTCTTCCATAGCCTTTTTCTTTCTTCTGTATTCTCTGGTTCGATCAATTCTATCAGGTTCGTAGACCTTCTGAGCACGAGCCACTTTTC
ACACTGCGGCAGAGGAACCAGGAGATAGTGAGCACTTGGAAGCCTTTGTGACCAATGCATGATGCATATGATGCATGATATGCAAATGCAAATGCGAAAGACTTCTTTTTTCATCGAAGG
ATTTTTAAACAAATTAGAAATCTTGCAGATAATCAAAACTACATAGTATTTTTAAAAGGAAGACTTTGAAATTTCAACAAGATAAACAAATGAAGCCCTCAAGCATAGGAAGTAGTCGGA
GGATCATCGGACTCGGAATCTGAATCACAGTATCTGGCAAAGAAGTCTCGCCGTCCTCTGGCTCTCTTGGAATCCCTCATAAGCAGCTCGTCTTTCTCTTCCAATTCCCTCCGGACCTTA
GCTAATTCCTTCTTCAACATCAGGTTCTCATGAGTCTTCTGCTCGTCTCTACCATCCAAAGTCATGATTAGATTCTCAGCTTGATTGTACCGAGCTTTCCACACTTGCTTCTCACGACTC
TCCATAGCTAGATGCTCCTGATACATATCCTGAGTCGCGGGGAGTAGAGGTAGAGGCATAGATGGGGTAGATGAAGACACGTATCTCATAGCTGGGTAAGGCATACCAATCTCCTCAGCT
CGATCTATCACCCACTGAGTATAGGCCTCGTGAGCAATACCGGATCTCACACCTAGATGCTTCACACTCTTCCTTCGAACCTTGGACCAAGCATCCATGAAAGCTTTCCTTTGTCCGGTA
GGAGCATTCGTGTAGAAGAAGAACTCTGGAGATGTAGCAAGATTGATGGGCTTCGACTTCATAGGGAAACCAAACTGTCTCATAGCAAGCTCGGGATTGTAGTTGATTCCTCCACGAGTA
CCAAGAAGGGGTACATTGAGAAAGTCCCCACAACCCATAATGATTTCCTTCACCTGAGCGGCAGGAGTGAGCCAGACGACCTCATTAGGAGTGAGGGCCATAATCCGCTGCGAGTAGGAC
CAGTTCTCCGAGTTGTCATGGAAGGAACTCGGAAGGTGCGAAATAAACCACCTATACAAAAGAGATATGCAGCAAAGAATATACCCACGGCCCTTGAGAGTCCTGTCATGAATGGCGTGG
TAGGTATCCGCTAGCAAAGTAGGAACCGGGTTCTTGGAATGAAAGATCTCGATAGCATTCATGTCCACGAAGTTATCAAGGTTCGGAAAGAGAATGAGCCCGTAGATAAGCAAAGCAAGA
ATAGCCTCGAGTGTATCCTGACGAGTAGTACTGAGATTAGCCTGCTCAAGAAGATACTTTGAAGTGAACCCCCGGATGTGAGACTTGGTAATAAGATGGTTGGAGACGTCGGAAGTCTTG
AGGTAGAGATCCTTAGCAATAACCAAAGGAGTAAGAGAAGTCCCGGGACCGGTGAAAGGCGTCTTCTCGGCTATAGGTAAACCCACTAGATTGGAGTAAGCCTCGAGAGTAGGAACCAAC
TGGAAGTCCGGGAAAGTGAAGCAACGGAAGCTCGGATCATAAAATTGCACTAGAGTGTGCACTAACTTCTCTTCCACATCGGTTCGGAGCAAAGTAAGCAATCCCCCATACCGGAGTCGG
AACCCTGTTTGACTCTTGACCTTGAGTGCCAACTCTCTTAAACTGACCAAATCCACTTCCTTGAACTTGTAGCACTTAGTCTTCTTCATACCTGTGATTATTTACAAAAATTTCCATTTG
TTTAAGCCCTTCGATGAATGCATGAAAAATGTTTATGCATGAATGCATGTATGCATGATTGTGTTGTTTAGTTACAAAGAACAAGGTGGGTTGAGATTCAAAGTAACAGGGCCACGGATG
GACACGGCGTCCGGTGAACTAAGGCTTTGGATAGTAGTAACCAAGGTTCTAACACAGTTCCCAAACTGCAACCTCTCTCACATATATCATGGTAGTACAGGACGACACCCGTTCCATGAT
TATTTGTGAGAAGGTCTAGTTTGAGTGTAGTATCGCGTGACGACTAAAGTTTGAGACAACACTCAATTTAGCCACCGCACTACGTCCTAAAAAGGCTAGGATGGGTTTGGTAACTACGGT
TCATAGCTTCGTCGAACAATTGAAAGTGAAGTGCCTAAGCATGACAACACACGCCGACAATATCACCTTCAAAATGCCTCAGCTATGTGAGATTGATCGCATAATCCAATACACGAGGCA
ACCCCCGGACCGAATTGTCGATTATATCTCTACCTAAACATAAGTTCACTCAGCCCGGGTATAGGACTTTTGATATTCTCACCCCACACGTCAAATGAAAGTAAACAAGTATTCACATAT
GTAAGCAATAAAACAAAGCGTAAATATAAACTAAGGAAAACTAGGCGCGACCCGCTAAAAAAATGTCCCCAGTGAAGTCGCCATTTCTGTTATCATGGTTTTTGGGTGCCAAGCCATTAA
TTGGACTTGAACCTTTTGACCGTTGATATTCTCTATTTTTTCTTGGGAAGGGCAAAATTGAGAAAAACCCTTAGATTCTAAGTTCGGGGGTCGTTTTCGCTACGGGAAGGTGTTAGGCAC
CCGGAACGATTATGGTATTCCATAAGAGCCGTTCTCCTAAGTTGATTTCTACGCTTTATTTTTTATTGCCTACTTGTAAAAAAAGAAGGTGTGATTAGTGAAGAATGGGGGTGAGAAGAA
GTAGAATTTGATTTTATTTCGGCTTGGAGGGTTTAAAGTCCCTTGCCTACGTACCGTTTTACGGGATCAAAACCGGCGTAGTTCTTGCTAAAAAGACTTGTGGTTTTTTGTTTTAATTGT
TTGATTTTAAATTTTGAAAATGATTTGAAGAAGGGGATTGAGAGGCTTCATGAGCATTAGAGTATGAAAAAGTGAGGGTTTGCTTAGTGATTTTGCAAAAGAAGTCTTAATGATTAGGTT
TATTTGAGAATTTGATTAAAAAAAAAAAAGGGAAAAATTATTGGAGTTTTGACTCCATTTCTTATGAAAAAAAATATTTGAAGTGAATTTGTTTGCATATTTTTTGGAAAAAAGTTGGAT
TTTCTCTAAGTGTTTAAACCTAAGCATTCATCTAACCATGCAATCCTAGGCATACATCTAGGGTGAGTGTGTGCGTGCCGGTGCGCCATAGTGTCCATAGTCCATATTACAAAAATTGCC
TAAATACATTCTATGGCCCCTTTGCCAAGCTACATACCAATGATAGCAAATTACATCACCAAATGAATTAAAATTTGCAAAAATAAATGCTAAGCTGAACAAAGTGGAGGAGATAGTGGT
GAAATGGACAAATGCTCATGAAATGAATGGAACAAAAGAAGTGAGATGATTAGTAAAATAAAGCATAGAATAAAACAAGTGCACAAAAATATTAAGAGGAAAGACATAAAAGAAACTAAT
AAAGTGACAAAATGTGCATGAAAATGGTCATAAGGCTCTAGCATATATATGACCCATAATCCCTTCATTATGACATTTTTAGAAGTCTTGCTTTGTGCCCTAATGTGAAAAAAAATGGGA
CATATTTGATGCTAAGTTTATGGTACACTTTCAAAATATTTTGGCACTTTATTTACTAGTAAAAATGCATACTAATTGCAGAACAAAAAGGGAGATGAAATTGAGATACACAAGCAGCAA
ATTAAACATGTAATCAGCAACAAACTTATCACAAAATTGCATTCCCAAAAATTCATATCACATGCCAACATTTCATGAGAAATACACTACTAAAAAATGCACAAATTTTTGTCTAATACA
CTAATTACCCAAGAAATATCACATGCTTTTTTTTTTATCATTTTAAAACCATTGAGAAATATAAAAAAAAAGGAAAATACATCAAGAAACATGTGATAATTTTTGGAGATTTTTTTTAGA
GAAAATTTAAGCATGCAGGGGTTCAAACAGCAAAGAAACATGGTGCAAATAGCAGGAAAATAAGCAAAAGCGCGCAAGAAGCCTAAGCCCAACCCAAAGCCCAACACACAAAACTCAGAT
TGCACAGGAGACGTTGGATTGATCCAGGGTAGGAAACCCTAGATCCAACGGCCAGGAATGAAGGAGATTGGACCGGTCCTGGACCGGTCCGGTTCACTGGCTATATAAACACATTAGCGC
CGGTTTTTTTTATTTTACACTCTTCTTTCTCTCTCTAAACTCTTCTCTCTCTAAACTCTTCTCTCTTCTCTCACCTCTCACCGGATTCTGGAAAAAATGGAAGATCTTCATCTTCCTCGG
TGAGGCTTGTTCCTCCGGCGTGGTGGCCGGCCGCCCAAGGGTGGCGGCGCCGCCGCCGGAGTTGAACGAACTTCACCGTTTTCAAAAAAACTTACGTTTTCAGATATCCTTTTTTATCCT
AAACACGAATATGGCACTGGATTTTACATGCAAGGCGTGAATCAACGTAGATCTACGGTTTTGTGTTACGGTTTTGAGAAATTTTTCTTGATTCTTTTTAGTGTTTTGTTGAATGAGAGC
TTTGGAACTTTACAGATCTGTAACTGATTCGTGCTTATGGATATTTTTGAGAAAGAAAGGCGAGTTTTACGTATTTTACCTGCGGTTTCAAACGGAGATTTCGAATCGGAATCTTTGAGA
AACTTGAATTCTGGTGCTGTTTGTTGATTTTTTGTTCTTGAATCCGAAAATGAACCGTTGTTTTCCTACTGGTTTGCTTTCTTTATCTCCTTCACCGGTTTGGATCTCTGATTCTTTCCC
TCTTCTTCTTCGCTTTGATCTCTGTGATCGGTGCTTGAGTCCGCCGTCAACAATGGCGGATTCGCGCCTAGAATTGCAGAAGCAAAGGTTCAATGATGATGATTACGCGCGAATCTCTGA
GAACCGTGAGAAAATCCAAGAAAAAACGGTTGAATTTGGATGAGTTCTGGCGAATTTCTGAACTAGGGTTCGTGATTTTTTCTTTGTTCTTGCTGATTTCTCTGTGATTTTGGTTTTGAT
CTAACTGACAAGAGAGAGAAAAATTGATTCTGTTTTTTGGTGAAGTGGCGTGTGGTTAATGGGTCTGTGTGGCACTGTACACCTTTTATAGCTGACATGTGTGATCTTGGACCAATAGAA
TTGTGACATCTGGACTTTAACTGAAAGAAACGTGAGTTTGACACTTTGAGCCCTTTTCTGCAAAATTGAAAAATTAAAGGACTAAAATGGAAATAACAAAAAGGACTAAAAATGCAAATA
GAAAGAATTCTGGACTGAAATGCAATTTTAAAAAAAAAGAGTTCTGGACTGAAAAGCAATTTTGGACCTCTTTGAGGACCAAAATGCAAAATAAAAAATAAAATTGAAATAAAATTGGTA
ACCTGACAAAACGTAAAGCGAAACAAAAATAAAATTGACAAAACGGACTAAAACGAACCAATGGTTTAAATGAGGTACTTCAAAGTAACCTCTCTATGCTAAAATTTTGTGTGAAATGAC
CAAAATGCCCCTAGGGCTAAAATGACCTAAACAGATTCAAATTGACTTGACACTGACTCAGATGCAAGTTTGAAATGAATTTAACAAGGTTTACTGATGCAATGTTAAAAATCAATCTGA
AAAGACTCAGAGACAGTCACAGGGATGAAAATGGGTCCCACTGCAGGAAACGACCAAAATACCCTTCTGTACGACTTTTTGCAAATTTTGAAATAAACTGTAGAAAAAGCAATGTAATGA
TTCAGAGACACTTTTGAATGACTTACAAGACAAGTAAAGACATTTCAAAAAGTTTTATGCAAGAAAAACATAGGTAAAATTGTGATTGAAAATACTGCGAGGCAGAGACAATTTGAACTG
TGCAGTTGAAATTTGATAATTGACAAAGTTTGAAATGAAACTGGGCCTAGTATTTTTAGGTCCAAAAACAGGGTATAACACGTTAACTTTCAAGTGTTCAAATAAACATTTCCCTAAAAA
AAAAAAGTGTTCAAATAAACATAATTTTCAGGTGTTTAAAGAAATTGTTCTTAGTGGTATTCATTAAGCACAACTTGTATTCAAATATACACTTGAAATTAGTTGTGGTTAATTGTGTTG
AATGAGAGATTAATGAATTGCAACACCTTGTTATATTTATTAAACATCTTATTAAAAGCATTGAAGCACATATGTGAACTGCATTAACCATTTAAATTAGATTTTAATATGTATTTCGTC
CCTGTAATTAGGGGTCATTTAAAAATTGGTCCCTGCAATCGTTAATCCTGACAAATTAGCCTTGCAAAGTTTAACCATTTAAAATTTCGTCCCTTGACCCGCTTAATGATTGCCACGTCA
TTAATTTGTGTAAATTTGGTCATTTTAAATTATTATCGTATTTTGATGTAAATTTCTAATAGTTTAATCATTTTAAATTATTATCGAATTTTGATGTAAATTTGTGTATCAGAGTATTAT
TTCTATCATATGTAATTTCACATTCCAATATGATACCAGCCCTTAATTAAAGAGTTGTTGGAATTTACAGCTAGGAGGCCCTTCATGGGATGTAGGCTTGGGAAGAAGGGACTCAATCAC
AGCTAGTAGGTCTGATGCCAATAACTCAATTCCTGCACCCTTTTTCAATCTAAGCACTCTCAAAACAAATTTTGCTAACCAAGGGCTCTCAGTTGAGGACTTGGTGGCTCTTTCAG
GTAC
CATAGTATTCCTATTAATGCTTTATCATGATTCATGACCACAACTTTATTCAAAAATTCTCTCGAAGAAGAATTTGACATTCAATTAATGTTCAATATTAGTACTATGTTTCAATTCAAT
TGAGTATATCTTGAATATCAGGTGCACATACAATTGGTCTCGCTCGATGTGTACAATTTCGAGCACACATTTACAATGACTCCAACGTTGACCCCTTGTTTAGAAAGTCTCTACAAAACA
AGTGCCCCAGAAGTGGAAATGACAATGTCCTCGAACCCTTCGACTATCAAACACCGACACATTTTGATAACCTATACTTCAAGAATTTACTAGCTAAAAAGACTCTTCTCCATTCAGACC
ATGAGTTGTTCAATATTGGAAGTTCTACTAATAATCTGGTAAGGAAATATGCTACTAATAATGCTGAATTTTTTAAAGCCTTTGCCGAGGGCATGGTCAAAATGAGTAGTAGCATCAAAC
CCCTTACAGGAAGCAATGGACAGATCAGAATCAATTGCAGAAAAACCAACTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAGCTTACTACTTCCTCTTAATTGTTCTTCTTGCAGCTTCTGAAATATCTGAAGCAGATGGCCAAAATGAGTTATGTACAGACTTTTACTGCAACAGCTGCCCGGAACTGTTGTCT
ATAGTGAACCAAGGAGTCGTAAATGCTCTTAAAAAAGAAACTCGAATAGGAGCTTCTTTACTTCGATTGCATTTCCATGACTGCTTTGTAAAT
GGCTGTGACGCATCGATTCTGTTGGAT
GATACAAGCAGTTTCATAGGAGAGAAAACAGCAGCAGCTAACAATAATTCAGCTAGAGGATTCAACGTGATTGATGACATCAAAGCCAGTGTGGAGAAAGCATGCCCCAAGGTTGTGTCC
TGTGCTGATATTCTTGCTCTGGCTGCTCGAGACTCAGTTGTTCAT
CTAGGAGGCCCTTCATGGGATGTAGGCTTGGGAAGAAGGGACTCAATCACAGCTAGTAGGTCTGATGCCAATAAC
TCAATTCCTGCACCCTTTTTCAATCTAAGCACTCTCAAAACAAATTTTGCTAACCAAGGGCTCTCAGTTGAGGACTTGGTGGCTCTTTCAG
GTGCACATACAATTGGTCTCGCTCGATGT
GTACAATTTCGAGCACACATTTACAATGACTCCAACGTTGACCCCTTGTTTAGAAAGTCTCTACAAAACAAGTGCCCCAGAAGTGGAAATGACAATGTCCTCGAACCCTTCGACTATCAA
ACACCGACACATTTTGATAACCTATACTTCAAGAATTTACTAGCTAAAAAGACTCTTCTCCATTCAGACCATGAGTTGTTCAATATTGGAAGTTCTACTAATAATCTGGTAAGGAAATAT
GCTACTAATAATGCTGAATTTTTTAAAGCCTTTGCCGAGGGCATGGTCAAAATGAGTAGTAGCATCAAACCCCTTACAGGAAGCAATGGACAGATCAGAATCAATTGCAGAAAAACCAAC
TGA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CGGCCGGGGA GTGTTCTCTA TAGCTTCTTA CATGGCAGCT TACTACTTCC TCTTAATTGT TCTTCTTGCA GCTTCTGAAA TATCTGAAGC AGATGGCCAA AATGAGTTAT GTACAGACTT  TTACTGCAAC AGCTGCCCGG AACTGTTGTC TATAGTGAAC CAAGGAGTCG TAAATGCTCT TAAAAAAGAA ACTCGAATAG GAGCTTCTTT ACTTCGATTG CATTTCCATG ACTGCTTTGT  AAATGGCTGT GACGCATCGA TTCTGTTGGA TGATACAAGC AGTTTCATAG GAGAGAAAAC AGCAGCAGCT AACAATAATT CAGCTAGAGG ATTCAACGTG ATTGATGACA TCAAAGCCAG  TGTGGAGAAA GCATGCCCCA AGGTTGTGTC CTGTGCTGAT ATTCTTGCTC TGGCTGCTCG AGACTCAGTT GTTCATCTAG GAGGCCCTTC ATGGGATGTA GGCTTGGGAA GAAGGGACTC  AATCACAGCT AGTAGGTCTG ATGCCAATAA CTCAATTCCT GCACCCTTTT TCAATCTAAG CACTCTCAAA ACAAATTTTG CTAACCAAGG GCTCTCAGTT GAGGACTTGG TGGCTCTTTC  AGGTGCACAT ACAATTGGTC TCGCTCGATG TGTACAATTT CGAGCACACA TTTACAATGA CTCCAACGTT GACCCCTTGT TTAGAAAGTC TCTACAAAAC AAGTGCCCCA GAAGTGGAAA  TGACAATGTC CTCGAACCCT TCGACTATCA AACACCGACA CATTTTGATA ACCTATACTT CAAGAATTTA CTAGCTAAAA AGACTCTTCT CCATTCAGAC CATGAGTTGT TCAATATTGG  AAGTTCTACT AATAATCTGG TAAGGAAATA TGCTACTAAT AATGCTGAAT TTTTTAAAGC CTTTGCCGAG GGCATGGTCA AAATGAGTAG CATCAAACCC CTTACAGGAA GCAATGGACA  GATCAGAATC AATTGCAGAA AAACCAACTG AAAATTAGTG AGTAATATTG TGTACGTATG CGTATACATA TATTATATAT GTGTGTAATT ATTCATATAT CTTTTCCAAA TTATGCCTAA  TGATATTGGA TCTTTTTTCA TTAGGCAAAT AAATGTAAAA CATGGCAAGA TATTCATTTA TAGCCAGGTT TGAATTGTAA GCATATATTC TAATAAAGTC TCAAGCTACA AATTTTTCAC 
ATGTG 

Retrieve as FASTA