Entry information : MtPrx38(Medtr4g095450.1[4.0] / Medtr4g095450.1[3.5] / Medtr8g099370.1[3.0])
Entry ID 363
Creation 2006-06-21 (Christophe Dunand)
Last sequence changes 2010-09-15 (Haythem Mhadhbi)
Sequence status complete
Reviewer Catherine
Last annotation changes 2022-03-25 (Catherine )
Peroxidase information: MtPrx38(Medtr4g095450.1[4.0] / Medtr4g095450.1[3.5] / Medtr8g099370.1[3.0])
Name MtPrx38(Medtr4g095450.1[4.0] / Medtr4g095450.1[3.5] / Medtr8g099370.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx013]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Flowers
immature pod walls
Leaves
Root tips
Roots
Seedlings
Inducers beta glucan elicitor preparation from Phytophthora sojae
Colletotrichum inoculation
Glomus intraradices infection
Glomus versiforme infection
Insect damage (Spodoptera exigua, Meloidogyne, Aphib)
Meloidogyne incognita
Methyl jasmonate treatment
Pathogen interaction
Phoma infection
Phosphate starvation
Rhizobium inoculation
Sinorhizobium inoculation
Wounding
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx38
start..stop
S start..stop
MsPrx12 659 0 1..323 1..323
TrPrx02 614 0 1..323 1..329
GmPrx23 573 0 1..323 1..325
LjPrx04 556 0 1..323 1..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 39800392..39800607 216 N° 2 39800719..39800919 201 N° 3 39801161..39801326 166 N° 4 39802752..39803140 389
join(39800392..39800607,39800719..39800919,39801161..39801326,39802752..39803140 )


exon

Literature and cross-references MtPrx38(Medtr4g095450.1[4.0] / Medtr4g095450.1[3.5] / Medtr8g099370.1[3.0])
Literature REFERENCE 1. Harrison,M.J. et al., unpublished
REFERENCE 2. Manthey,K., Bartelsmeier,V., Baier,M.C., Meyer,F., Bartels,D., Bekel,T., Linke,B., Grunwald,U., Franken,P., Kuester,H., Perlick, A.M. and Puehler,A. Detection of transcript sequences from mycorrhizal roots of the model mycorrhiza Medicago truncatula genotype A17 - Glomus intraradices using the approach of an EST genome project. Unpublished (2002)
Protein ref. UniProtKB_Uniparc:   Q1SEC3
DNA ref. Phytozome 12:   chr4 (39800392..39803140)
Cluster/Prediction ref. Phytozome Gene 12:   31106365
Omic ref. Gene atlas:   Mtr.47795.1.S1_at Legoo:   Mtr.47795.1.S1_at
Protein sequence: MtPrx38(Medtr4g095450.1[4.0] / Medtr4g095450.1[3.5] / Medtr8g099370.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (298)
PWM (Da):   %s   35284.87 (32445.4) Transmb domain:   %s   i7-24o
PI (pH):   %s   9.13 (9.13) Peptide Signal:   %s   cut: 26 range:26-323
Sequence 364
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRYNVILVWSLALTLCLIPYTTFAQLSPNHYANICPNVQSIVRSAVQKKFQQTFVTVPATLRLFFHDCFVQGCDASVLVASSGNNKAEKDHPENLSLAGDGFDTVIKAKAALDAVPQCRNKVSCADILALATRDVINLAGGPSYTVELGRFDGLVSRSSDVNGRLPQPSFNLNQLNTLFANNGLTQTDMIALSGAHTLGFSHCDRFSNRIQTPVDPTLNKQYAAQLQQMCPRNVDPRIAINMDPTTPRTFDNVYYKNLQQGKGLFTSDQILFTDTRSRNTVNSFATNGNVFNANFITAMTKLGRVGVKNARNGKIRTDCSVL

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 3 introns) and 44 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGTCGTTATAATGTTATACTTGTGTGGTCACTAGCATTAACGTTGTGTCTTATTCCATATACAACTTTTGCTCAACTTAGTCCAAACCATTATGCTAACATTTGTCCTAATGTTCAAA
GCATTGTAAGATCAGCAGTTCAAAAGAAATTTCAACAAACTTTTGTTACTGTTCCTGCTACCCTTCGTCTCTTCTTTCATGATTGTTTTGTTCAG
GTAATTAATTTCGGCATTTGTCAGT
TGAGCTAGGACTTCTATAGACTATATTAATATCAGTATAGTGTATTAAAATTTTTGATTTGTGATATGATTATTATTTTGTTATAGGGTTGTGATGCTTCAGTTTTGGTGGCATCAAGTG
GAAATAACAAAGCTGAAAAGGATCATCCTGAAAATTTGTCATTGGCTGGTGATGGTTTTGACACAGTGATTAAAGCAAAAGCTGCATTAGATGCTGTTCCACAGTGCAGAAACAAAGTTT
CTTGTGCTGATATTCTTGCTTTGGCTACTCGAGATGTTATTAATCTG
GTTTGTTCTTCAACTTGATTTGAATTATTTTACGTTAACGCTTTTCGATTTTTATATTATTTTTTCTCTCTGT
GGTCAGACACCACACATTTGAATTGGATTGTTCATATGTGTCAATACGGTGTCTGAGTTATGTGCACTCAAATAATGTGTACAATTGGTTATGACACGTGATATGATATCAAAATCTATG
GATAAAAATAAAACTTTGATTTATCACTGTCAATTTCGTACATTACAGGCTGGTGGTCCATCCTATACAGTAGAATTGGGAAGGTTTGATGGTCTAGTTTCAAGATCTTCAGATGTAAAT
GGAAGGCTCCCTCAGCCAAGTTTCAATTTGAATCAGCTGAATACTCTCTTTGCAAACAATGGACTCACTCAAACAGACATGATTGCCCTATCAG
GTAATTGTCGAAGGCCACCATTTTAA
TTAAATGGGTCCCATTAGCATTTAGAAATTTCATTCCAAAACATATATTTTATACGTAAATAAGCTACATATTTCTTACTATGTGTCAAGATTCAAGAGAGTTTTTAAATGGCGGTAAAA
ATAAATAGTTTTGAAAAGCCTTGACAAAAAAGATAGTGTTATTTTTTTTAGGAGAAAACGAGAGTTCTAACTTCTAAGTACATAATTAACTTGAAAAGATGACGTATCACATAAGAAAGA
GATTCCTCTTGACAAATGATCGGTTAAGTTTAGATAAAATAATAAAAAAAATAAAAGGACCACTTAAGAATATTTTGGTTACCAGAACTTTTTTTTGGGTATTATTTTAAGGAAATTAAA
TTTTTAATATTTTGACATATAGACTAATGCATATACAAATAATTATCATTGGCCAGTTGTCACTTAATTTAATGTGGTCACTAAAAATTATTGAGTTTACTTTTATAGTTTAATTTTCGT
ATAGTCTCTGTTTTTTAATTTTTGCTTTGGAGTTCAATATTGTGTGGATATTTAGATAAATGTTAGTATCATTAGTAATATCAAATGTCAACTTAATTAAATGATTCTTGAAAAAAGCTT
AATTAAATGATGTCACAATCTTGTTTGGTTTTACGTCTCTTTCTACTCTTTACACCTTTGAATATAAGTATAATTTTTTTACAGCAATAATACACTAAAATCAAATCATAATTTTAATAT
ACATAATCATGGCAAACAGGTTTTACATAATCACTAACAAATTATTTTAAATTTAATTATGTCAACAGACTCATCAAATAATATATCAAATAGTTATAATTTTAATATACATAGTCATGG
TAAATAGGTTTTACATAATCACTAACAAATATTTTAAATTTAATTATGTCAACAGATTCATCAAATAATATATCAAATAGTGAATCAAAATTAAATTTATCTATATGCATTATTTATTTT
TTTACTTGTTGAATCTCAATAAAACATGTTGTATACTGTTCTCTAGGAGTGAATTATTCATAGACACTAGCTTGAACTGTTTAAAAAATTATTGATAGACTCCATCTTTCAAATAATTCA
TGTATTAAATTAAATACAATAAAACCACAATCATTAGTCAATTCTAATCGAAATCTGATCAAATAATTTATCTCTATTATTAGTTTGGTTTACAAAATAAATTAAGTAAATATTTTTTTT
TGAAATATCTAAAAAGCTATTATAGTCAGAGCATCCAATCCAAATCACTAAAATAACATTAAGAAAAGAATCTAATCTTGAAGCAAAAGCCAACAAGTAAACAAAACAACAAAAACTGAA
CCAGACAGTTCATACTTTTGTAGTATTCACATTTTGTTCCCTCTATGAACGTGCTTATTTTCTTTTTCATATTTTACAGGTGCACACACTCTTGGATTCTCTCACTGTGACAGATTCTCC
AATAGAATTCAAACTCCAGTGGACCCCACATTGAACAAACAATATGCTGCCCAGTTACAACAAATGTGCCCTAGGAATGTTGATCCAAGAATAGCCATCAACATGGACCCAACAACTCCT
AGAACATTTGACAATGTTTACTACAAAAATCTTCAACAAGGAAAAGGTTTATTTACTTCTGATCAAATCCTCTTCACTGATACAAGATCAAGGAACACTGTTAACTCTTTCGCGACTAAC
GGTAACGTTTTCAATGCCAATTTCATCACTGCCATGACCAAGTTGGGTCGTGTTGGAGTTAAAAATGCGAGAAATGGGAAAATTCGTACCGATTGTTCTGTGCTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGGTCGTTATAATGTTATACTTGTGTGGTCACTAGCATTAACGTTGTGTCTTATTCCATATACAACTTTTGCTCAACTTAGTCCAAACCATTATGCTAACATTTGTCCTAATGTTCAAA
GCATTGTAAGATCAGCAGTTCAAAAGAAATTTCAACAAACTTTTGTTACTGTTCCTGCTACCCTTCGTCTCTTCTTTCATGATTGTTTTGTTCAG
GGTTGTGATGCTTCAGTTTTGGTGG
CATCAAGTGGAAATAACAAAGCTGAAAAGGATCATCCTGAAAATTTGTCATTGGCTGGTGATGGTTTTGACACAGTGATTAAAGCAAAAGCTGCATTAGATGCTGTTCCACAGTGCAGAA
ACAAAGTTTCTTGTGCTGATATTCTTGCTTTGGCTACTCGAGATGTTATTAATCTG
GCTGGTGGTCCATCCTATACAGTAGAATTGGGAAGGTTTGATGGTCTAGTTTCAAGATCTTCAG
ATGTAAATGGAAGGCTCCCTCAGCCAAGTTTCAATTTGAATCAGCTGAATACTCTCTTTGCAAACAATGGACTCACTCAAACAGACATGATTGCCCTATCAG
GTGCACACACTCTTGGAT
TCTCTCACTGTGACAGATTCTCCAATAGAATTCAAACTCCAGTGGACCCCACATTGAACAAACAATATGCTGCCCAGTTACAACAAATGTGCCCTAGGAATGTTGATCCAAGAATAGCCA
TCAACATGGACCCAACAACTCCTAGAACATTTGACAATGTTTACTACAAAAATCTTCAACAAGGAAAAGGTTTATTTACTTCTGATCAAATCCTCTTCACTGATACAAGATCAAGGAACA
CTGTTAACTCTTTCGCGACTAACGGTAACGTTTTCAATGCCAATTTCATCACTGCCATGACCAAGTTGGGTCGTGTTGGAGTTAAAAATGCGAGAAATGGGAAAATTCGTACCGATTGTT
CTGTGCTTTAA

Retrieve as FASTA  
cDNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ACTAGTCTAT TCATATATTC TAGTACCCTT TTGCAAATGG GTCGTTATAA TGTTATACTT GTGTGGTCAC TAGCATTAAC GTTGTGTCTT ATTCCATATA CAACTTTTGC TCAACTTAGT  CCAAACCATT ATGCTAACAT TTGTCCTAAT GTTCAAAGCA TTGTAAGATC AGCAGTTCAA AAGAAATTTC AACAAACTTT TGTTACTGTT CCTGCTACCC TTCGTCTCTT CTTTCATGAT  TGTTTTGTTC AGGGTTGTGA TGCTTCAGTT TTGGTGGCAT CAAGTGGAAA TAACAAAGCT GAAAAGGATC ATCCTGAAAA TTTGTCATTG GCTGGTGATG GTTTTGACAC AGTGATTAAA  GCAAAAGCTG CATTAGATGC TGTTCCACAG TGCAGAAACA AAGTTTCTTG TGCTGATATT CTTGCTTTGG CTACTCGAGA TGTTATTAAT CTGGCTGGTG GTCCATCCTA TACAGTAGAA  TTGGGAAGGT TTGATGGTCT AGTTTCAAGA TCTTCAGATG TAAATGGAAG GCTCCCTCAG CCAAGTTTCA ATTTGAATCA GCTGAATACT CTCTTTGCAA ACAATGGACT CACTCAAACA  GACATGATTG CCCTATCAGG TGCACACACT CTTGGATTCT CTCACTGTGA CAGATTCTCC AATAGAATTC AAACTCCAGT GGACCCCACA TTGAACAAAC AATATGCTGC CCAGTTACAA  CAAATGTGCC CTAGGAATGT TGATCCAAGA ATAGCCATCA ACATGGACCC AACAACTCCT AGAACATTTG ACAATGTTTA CTACAAAAAT CTTCAACAAG GAAAAGGTTT ATTTACTTCT  GATCAAATCC TCTTCACTGA TACAAGATCA AGGAACACTG TTAACTCTTT CGCGACTAAC GGTAACGTTT TCAATGCCAA TTTCATCACT GCCATGACCA AGTTGGGTCG TGTTGGAGTT  AAAAATGCGA GAAATGGGAA AATTCGTACC GATTGTTCTG TGCTTTAATC AAGTGTATAA TGTAAGCTGG GGAAGTCACA AAGGGTGACT ATAGATTATT TGTTAATTAA TGTTAATAAA  TTTGTTTGCC AACAAATTAA GAGTGGTTTG GATGTTAAAA AAAGGAAGAT AAGGGGAGAG AAAAAATTGA GCTTTTCTTT GATGTAATTT AAGTTCCAAA TAATTCAGTG TCCCCTATAT 
TTATGAACTT TGAATTGTTT ATTGAAAATG AATAAGAGTG CTGCT 

Retrieve as FASTA