Entry information : HsGPx04-B
Entry ID 3632
Creation 2006-08-23 (Christophe Dunand)
Last sequence changes 2016-06-28 (Harold Duruflé)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2016-06-28 (Harold Duruflé)
Peroxidase information: HsGPx04-B
Name HsGPx04-B
Class Animal glutathione peroxidase    [Orthogroup: Gpx1002]
Taxonomy Eukaryota Metazoa Chordata Mammalia Hominidae Homo
Organism Homo sapiens (human)    [TaxId: 9606 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value HsGPx04-B
start..stop
S start..stop
PtroGPx04 353 5.08e-126 1..168 1..168
PpyGPx04-A 353 5.08e-126 1..168 1..168
HsGPx04-A 353 5.08e-126 1..168 1..168
MnemGPx04 352 1.61e-125 1..168 1..168
Gene structure Fichier Exons


exon

Literature and cross-references HsGPx04-B
Literature Oh,J.H., Yang,J.O., Hahn,Y., Kim,M.R., Byun,S.S., Jeon,Y.J., Kim,J.M., Song,K.S., Noh,S.M., Kim,S., Yoo,H.S., Kim,Y.S. and Kim,N.S. Transcriptome analysis of human gastric cancer. Mamm. Genome 16 (12), 942-954 (2005)
Protein ref. UniProtKB:   P36969-2
DNA ref. GenBank:   NC_000019.9 (1104043..1106636)
mRNA ref. GenBank:   NM_001039847
Cluster/Prediction ref. Genebank:   2879
Protein sequence: HsGPx04-B
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   227 (202)
PWM (Da):   %s   24793.51 (22304.1)  
PI (pH):   %s   9.39 (9.11) Peptide Signal:   %s   cut: 26 range:26-227
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLGRLCRLLKPALLCGALAAPGLAGTMCASRDDWRCARSMHEFSAKDIDGHMVNLDKYRGFVCIVTNVASQUGKTEVNYTQLVDLHARYAECGLRILAFPCNQFGKQEPGSNEEIKEFA
AGYNVKFDMFSKICVNGDDAHPLWKWMKIQPKGKGILGNAIKWNFTKFGHRLSTVPHRQERLRGEALRTHGGAPGDREGPAPLFLAPQVCGPARAPAHALGAFHRHS

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 19, 6 introns). This variant (2) uses a frame-shifting alternate splice site in the 3' coding region, compared to variant 1. The encoded isoform (B) is longer and has a distinct C-terminus, compared to isoform A
Promoter
Send to BLAST
Send to cis Analysis
Terminator +
Send to BLAST
Send to cis Analysis
DNA
Send to BLAST
CDS
Send to BLAST