Entry information : MtPrx39 (Medtr1g115900.1[4.0] / Medtr1g115900[3.5] / Medtr1g146230.1[3.0])
Entry ID 364
Creation 2008-10-07 (Christophe Dunand)
Last sequence changes 2008-10-07 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-25 (Catherine Mathe)
Peroxidase information: MtPrx39 (Medtr1g115900.1[4.0] / Medtr1g115900[3.5] / Medtr1g146230.1[3.0])
Name (synonym) MtPrx39 (Medtr1g115900.1[4.0] / Medtr1g115900[3.5] / Medtr1g146230.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx378]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Seedling roots
Inducers Glomus intraradices infection
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx39
start..stop
S start..stop
GmPrx29 469 1.15e-167 2..323 24..349
AhPrx04 424 2.37e-150 12..321 10..316
EgrPrx167 419 2.15e-148 12..321 11..320
ShPrx06-1B 412 1.33e-145 1..321 1..320
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '364' 'complement(join(52343098..52343519,52343823..52343985,52344072..52344263,52344483..52344698))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52344483..52344698 214 N° 2 52344072..52344263 190 N° 3 52343823..52343985 161 N° 4 52343098..52343519 420
complement(join(52343098..52343519,52343823..52343985,52344072..52344263,5234448 3..52344698))


exon

Literature and cross-references MtPrx39 (Medtr1g115900.1[4.0] / Medtr1g115900[3.5] / Medtr1g146230.1[3.0])
Literature VandenBosch,K. et al., unpublished, Journet,E.P. et al., unpublished.
DNA ref. Phytozome 12:   chr1 (52344698..52343098)
Cluster/Prediction ref. Phytozome Gene 12:   31095964 UniGene:   Mtr.9901
Omic ref. Gene atlas:   Mtr.11242.1.S1_at  Mtr.34465.1.S1_s_at Legoo:   Mtr.11242.1.S1_at  Mtr.34465.1.S1_s_at
Protein sequence: MtPrx39 (Medtr1g115900.1[4.0] / Medtr1g115900[3.5] / Medtr1g146230.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   330 (305)
PWM (Da):   %s   36187.67 (33555.4)  
PI (pH):   %s   6.5 (6.25) Peptide Signal:   %s   cut: 26 range:26-330
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALSSVKGFFCLLLITCMIGMNTSAELSENFYGKTCPKAVRTIRK
AVQDAVMNERRMGASLLRLHFHDCFVQ
GCDASALLDDTSNFTGEKNAFPNANSLRGFELIDDIKSQLEDMCPNTVSCSDILALAARDGVAELGGQRWNVLLGRRDSTTANLSEANTLPAPFLNLDGLITAFAKKGFTAEEMVTLSGA
HTIGLVRCRFFRARIYNETNIDPAFAAKMQAECPFEGGDDNFSPFDSSKPEAHDFDNGYYQNLVKSKGLIHSDQQLFGNGTSTNAQVRRYSRNFGRFKKDFADAMFKMSMLSPLTGTEGE
IRTNCHFVNAPISNTTTA

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 1, 3 introns) and 5 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAGTTCTGTTAAAGGCTTCTTTTGTTTGCTATTAATTACATGTATGATTGGGATGAATACTTCAGCTGAGTTATCAGAAAATTTCTATGGTAAAACTTGTCCAAAAGCTGTT
CGCACAATTAGGAAAGCAGTGCAGGATGCTGTGATGAATGAGAGACGTATGGGAGCATCCTTGCTTCGTCTCCATTTCCATGACTGCTTTGTGCAA
GTAATTAATTACTCTCATTTCTTT
TCATATACTATATATTAATTAATTTGATACGTACATGTGAATATACATAATATATAATGTTGCATATGTTTAAATATTTTCACTAATATTGCCCTAGGACTCAAACTTTAGATTATCAGA
GTTCTCTTTTCTCTGGAAACCGGGTTACGACATATATATATATATATATATCATGTACTATACACATACATGCAGGGGGATGTGATGCATCAGCATTGTTAGACGACACATCAAATTTCA
CAGGAGAGAAGAACGCATTTCCAAATGCAAATTCGCTAAGAGGTTTTGAGTTAATAGATGACATCAAATCTCAATTGGAGGATATGTGTCCCAATACTGTCTCTTGTTCTGACATCTTAG
CCCTTGCTGCTAGGGACGGTGTTGCTGAG
GTAAATATATACATTACAAACACATTTGATCTATACAATATTCTTATTAATTAATTTGATAATAACTAAGATTAAATTATGTATAGCTCTT
GGTGGACAAAGATGGAATGTACTATTAGGCAGAAGAGATTCAACAACAGCAAACTTAAGTGAAGCTAATACGTTACCTGCTCCCTTTTTGAATCTTGATGGCCTTATCACTGCTTTTGCC
AAGAAAGGTTTCACAGCCGAAGAAATGGTTACCCTATCAG
GTAATTAATTAGTAGTAATAGTGCACGCATTCATTTAGTTGACACATTACACGTAGGCCGATCGATGGTCCGAGATGATC
TCAAGTAATTTTTTATTTTTATTTCAAAATCTAAAATATCGAACTTGAAATCTACACATGGCCGGGGCGAGTGCATGAATGCATGCAGTAGTTCTAACTTCATGAAATCCAAATCGATGA
ATGACATATTTATTTATGAAAGACAAATTAAACACCGTACATGACACACTGACATGTGTCTGTTTTGTATATAACAGTTTTGATGGTTTTGTTGGTTGGTCAGGTGTGCTCACACAATAG
GTCTAGTAAGGTGCAGATTTTTCAGAGCAAGGATATACAATGAAACAAACATAGATCCAGCATTTGCTGCAAAAATGCAAGCAGAGTGTCCTTTTGAAGGGGGTGATGACAATTTCTCTC
CTTTTGACTCCTCCAAACCAGAGGCTCATGATTTTGATAATGGTTACTACCAAAACTTGGTGAAAAGTAAGGGTCTGATACACTCTGATCAGCAACTATTTGGTAATGGAACATCCACAA
ACGCTCAAGTGAGAAGATATAGCAGAAATTTTGGACGTTTCAAAAAAGATTTTGCAGATGCAATGTTTAAGATGTCAATGCTTAGTCCACTTACTGGCACTGAAGGTGAAATCAGGACAA
ACTGCCATTTCGTCAATGCTCCAATATCAAACACTACCACTGCTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTTAAGTTCTGTTAAAGGCTTCTTTTGTTTGCTATTAATTACATGTATGATTGGGATGAATACTTCAGCTGAGTTATCAGAAAATTTCTATGGTAAAACTTGTCCAAAAGCTGTT
CGCACAATTAGGAAAGCAGTGCAGGATGCTGTGATGAATGAGAGACGTATGGGAGCATCCTTGCTTCGTCTCCATTTCCATGACTGCTTTGTGCAA
GGATGTGATGCATCAGCATTGTTA
GACGACACATCAAATTTCACAGGAGAGAAGAACGCATTTCCAAATGCAAATTCGCTAAGAGGTTTTGAGTTAATAGATGACATCAAATCTCAATTGGAGGATATGTGTCCCAATACTGTC
TCTTGTTCTGACATCTTAGCCCTTGCTGCTAGGGACGGTGTTGCTGAG
CTTGGTGGACAAAGATGGAATGTACTATTAGGCAGAAGAGATTCAACAACAGCAAACTTAAGTGAAGCTAAT
ACGTTACCTGCTCCCTTTTTGAATCTTGATGGCCTTATCACTGCTTTTGCCAAGAAAGGTTTCACAGCCGAAGAAATGGTTACCCTATCAG
GTGCTCACACAATAGGTCTAGTAAGGTGC
AGATTTTTCAGAGCAAGGATATACAATGAAACAAACATAGATCCAGCATTTGCTGCAAAAATGCAAGCAGAGTGTCCTTTTGAAGGGGGTGATGACAATTTCTCTCCTTTTGACTCCTCC
AAACCAGAGGCTCATGATTTTGATAATGGTTACTACCAAAACTTGGTGAAAAGTAAGGGTCTGATACACTCTGATCAGCAACTATTTGGTAATGGAACATCCACAAACGCTCAAGTGAGA
AGATATAGCAGAAATTTTGGACGTTTCAAAAAAGATTTTGCAGATGCAATGTTTAAGATGTCAATGCTTAGTCCACTTACTGGCACTGAAGGTGAAATCAGGACAAACTGCCATTTCGTC
AATGCTCCAATATCAAACACTACCACTGCTTAA

Retrieve as FASTA