Entry information : AmelPxt01
Entry ID 3670
Creation 2007-01-09 (Marcel Zamocky)
Last sequence changes 2016-01-15 (Achraf Jemmat)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: AmelPxt01
Name AmelPxt01
Class Invertebrate peroxinectin    [Orthogroup: Pxt001]
Taxonomy Eukaryota Metazoa Arthropoda Insecta Apidae Apis
Organism Apis mellifera (Honey bee)    [TaxId: 7460 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmelPxt01
start..stop
S start..stop
NviPxt02 922 0 28..774 26..774
TcasPxt02 637 0 93..772 33..696
FchPxt01 449 3.09e-148 102..770 4..652
PlenPxt01 452 5.74e-148 102..770 137..785
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3670' 'join(2354969..2355050,2361450..2361593,2375031..2375337,2377658..2377875,2380546..2380584,2381676..2381852,2382003..2382199,2382310..2382493,2382740..2383082,2383176..2383506,2383657..2383855,2383945..2384054)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2354969..2355050 80 N° 2 2361450..2361593 142 N° 3 2375031..2375337 305 N° 4 2377658..2377875 216
N° 5 2380546..2380584 37 N° 6 2381676..2381852 175 N° 7 2382003..2382199 195 N° 8 2382310..2382493 182
N° 9 2382740..2383082 341 N° 10 2383176..2383506 329 N° 11 2383657..2383855 197 N° 12 2383945..2384054 108
join(2354969..2355050,2361450..2361593,2375031..2375337,2377658..2377875,2380546 ..2380584,2381676..2381852,2382003..2382199,2382310..2382493,2382740..2383082,23 83176..2383506,2383657..2383855,2383945..2384054)


exon

Literature and cross-references AmelPxt01
Literature Zhang,L. et al., Direct Submission(04-NOV-2010) Human Genome Sequencing Center, Department of Molecular and Human Genetics, Baylor College of Medicine.
Protein ref. GenBank:   XP_392481.4
DNA ref. GenBank:   NW_001253451.1 (2354969..2384054)
Protein sequence: AmelPxt01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   776
PWM (Da):   %s   87089.28  
PI (pH):   %s   7.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MFLIAPVDNNRWAYTMHGLEKPMDHVSAGGLMAGSVATLAILWVSLQTMGFLGNTHTIGAYKLPISLQNYLASYTGLPMTNYPYEGGVVDTGRTHNRRYPHIDEAVLNNSISFAQSLVDR
MSTLERNIANAGVELMAHTPAGKQFLDSYPSEDAFERGLDAIVAMKASSYLLHQSCH
RFGLDPPHRARFISTLSLEGTPLNSTCPSSRHKGCNSLAKYRNIDGSCNNVQNPSWGSAMTAY
TRILFPQYF
GCPGREILSSSRMWIQEPRRMGHTRKPLPGARSISVAVSTPNDQSDVSRTLTVMQWGQFVANDISYTPMRKMVSTGKPISCCRSDGNTLSPRYVHPDCSVIMVPDRDPIYG
QHYVRCMNYVRSLPVLKAECTFGPAE
MNQASHFLDGSAIYGSTLKKSRQLREFEGGRLRVHKESNHEFLPIGEDEISSACAKNCYNSGDYRVNTHPQLAVIHTIWHREHNRIADKLAELN
PNWSDETLFQEARRIVIAEIQHITYKEWLPILLGKRYTRAVGLTVGNSYSRNYNSEDDPAISNEVATAALRFLTSLMQGKI
SLTDDKRQINKTVSLSEYFFKPIIIESDEVFDGLLRGMA
TQTSQKMDVSIIEDVTSKLFAAGQDSLGLDAISLDIQRGRDHGLPGYNHYRKYCGLPIANTFDDFLDYISV
MMKKLRALYAHPDDVDLIIGGMAERPVDDGLLGPTFRCLIFEQFSRTRR
TDRYFYDSAYQPHPFTP
EQLAQIRNVTLARIFCDNGNNITQMQPNVFLRPQAE

Retrieve as FASTA  
Remarks Complete sequence from genomic. Strain="DH4". Similar to peroxinectin. Phylogenetically on the branch with Dm chorion peroxidase
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTTATTGCACCAGTGGACAATAATCGCTGGGCCTATACGATGCACGGATTGGAGAAGCCTATGGATCACGTGTCTGTGGTAATGTGCCTGCTAACTATATTTTAAATATTTACT
CGTAATCAATGCCTTTTATTATCCGGTATCTTGACGCACACGTAAGATTTTCATGATTTTTATTATATAGAAGCAAACAAAGATTTTGTAAAATTTAAATATTCGTGTATTATTATATCT
ATATTAATTTTCTTTAATCCTTTAAATTATCCAAAATTAAAATTAAAATTTAATTATTCTTTCCAAGTTTAAGCATCATTGTTAAAAAATAAAAGATAATTATATTATTGTAAGACGCGA
GGAGTAAGACTAATAATGCCTAGAGATTTAATTTTATTTTATCCTCGTGTTTTATTACAATGTTCGGTTCCGTTAATTTAGTTGGCCTACAAAATAACAGGCAGTAAAGAAAATAATATC
ATTTTCAATATTTCAATAAAAGCACACGTACTTAAAATATTTATTTCCTACGATAAGTAAATCGTTTTGTAAATCGCTTGCTCGCAAACTAATACAATTTTTCTAACTTTTTTATTAAAA
ATAACGACAGTAATAAAATATGTATTATTTATCTCGATTATACATTCTAAACGAATTTTGTGAAAGTTAGAAAATAGAAAATTCGAGATATTTAATACTATATTTCAAATGTTATACTTT
ATTATTATTATTTATTATTCTTAGAATTTTATATTGATTTTTTTTTTTTTTTTTTACGATTTCTATACTCCAAGTATTTTCTCTAGTACAGTATCTTGTTACTGTTATGAAATATAGAAT
GTAGCTACTTATCTCTCAGAGTATTGTACTCGTTCACCTCGTACTACTGCACTGGTAGATATATACGATATACCGCTTGAATATATAAATTTAATAATTTAATATTAATAACCAATTTAT
TTCTTATTCAAAGTACGGACATTAAAAGGAAAACAATAGTTTTCAATTCTAAGGAAGAAATTTTAATTATGTAGTAATCTCAAAAATATTGAATTTTTAATTTTTATCGTAAAAACTTTT
TTATTCGAGTATGTTTATATCTAAATAGCAAGACAAGACAAGTTGAAGACAATATTACGAAAGTAAATATTGAGACACACGTCCTGGGAATTCGACCGGTAATTTCCGAATCCAAACGAA
TTATTCTATACAACGTGTGTGTTCAAATTCTCACATCATACAGTGGAAAAAATTGTTAAATTAAATATTGAGTCAACTTTACGAAATCCACGGAATCGACAATTAAGATTGAAAGAAAAT
TGACCGAGTATTTCATAGTGAAAAATTGAATTGAATGAGCTGATTACTTGTCTCTTTCTTGCTCTATTGTTTCTCTTGCTTCTGAAAACATTACTTAAATTATTCGTATATATATTTGTA
TAAAAATACATAAGTTAAACGAAATTTGAAACTTTTATTGAAATTTCAAATAAAAAAAAAAAAGAAAGAAAAAAAGAGGAAAAAATGTTGAGTACAAACAATAATATTGATTTTTCGTAT
CTGAAATGTTATCTAGGTCAAGATACTATTTTTTAAAACACTTAGTCATTTATCAATATCTCGATTGCACTTATATTTATATGTATATAGTTATATAAATAACATACATACAAATAAAAA
TTTTTAAAAAAGATATCAATAACGAAATTGCATCGTATAATGCAAAATATTCTAACATTATATTTAAACGTAGTATAATAGTGAATATGTATGTATATACAGTAGTTAGAAAGTGAATTT
TCATATTGCCCTTGTTAGAAATATTTTAAAATTAAAATATCTTGTCGTACTTTATCTACTGTACATTATTGATTGAAAAATGTGGTAGTGAAAAAATTTAAAAAATATTTTTGTGAACGA
TCAAATGATACGATAAATAAAAAAAAAAAAATAAAATTTATTCAAAAATTGAAATGGAAATTTTGATAAGTTATAAGTAATAAATTATTTTTTTAAACTAATATCATGCTATAATGGTGG
ATTTTGAGTCATTATTATTGTAGAAAATAATTTTAAAAATTCGTAGAAATATACGATGTGTTTTTAATTACAGCTAATTTAATATTCTAATAATAATCATACAAGTGTTTGAATTAATAA
AGATGAATTAATACATTGAAAAAAACATTTGCACTCCATATGCGTTGTATATTCGTTTTTTTAGATTAATGTGGATTATACAAAAGAAACGAATAAAATTAAAGAATAATTAATAAGTTT
ATATAACTATAATATATATTAGAATATTAAATTCTAATATTAGCACCAGCAATATGATATTAATTTAAAAGTTAATTTAAATGATTTAAGAAAAATCTTGAATCAAATTAAAATTTGATT
ATGAAATGTAAACTAAGTAAACTAACTCTAACTTTTAATAATTCTAAATTATCCGTTTATAAATCTTTTTATTCGAAAAAAAAAACATTTTAGAAAATTGTAATTCTCACCATTTCTAAT
TTCAAATCTAAACCTCTTCTGGAATATTTTATAATATAATAAAATAAAATTGAAAGATTACTCTTTATATTATTGGAATGGCCATTAAGCGTATTCGGTTTATTAAAGTGATGATTGTAA
TAACCGTTGTAACTTGAGCTACACCGTGATGTAACGAAACTCATCTTCTTCAACTCGTACTCGTAGAAAGGAGGCGTGAAAAATGCGCCTCTGTATTTTACAGCAGCAACATATGGCATT
CATTTTATAAACACGTATCTCGATGAGACGTGCTGGCAAAAATCGAGTTATCTGGTTAAAAAAAAAAAAAAAAAAAAGTAGAAGAACGTCTACGTTTCCTTCGCACAATTGCATTTAACT
GTAAATTCGCATTTTCATTTTTAAACAAATCACACCTTCGACACTATTTCCGTTCTCACGAAGAGGTATTCCACAATCAGGATATGTAATGAATCATTCTCGTTAGACGCGACTAAATTT
AAATACGATTACGCTCACTTTGTAACTTTGTTTCGAAAAAGAAGATTTATTGTTTACGTTTGTAAAACCGAAAGATAGGATAGGAAGAGGATATTTTCATTTCTTATAAATATTTTCGAT
TTATATTCGAAAACAGAAACGATTAGATAATTTTACCGCTTTACGTTATATAGTATAAGTCATGCATAGAAATTATTTTGAGACATTTATATTTAGAAATTGATACTCCAAATATGAAAT
TTCTCGAAATAATTTCTTCGTATATATTTTTATGTTATCATATTTCGTTGAATATTGAATTGGATTTGTAATAATTAATGTAACTTAGTAATCTAAATTAATATAACTATACTAATCGAA
CTTATACTGCTACGATTTTCAACCTTCCATCAGACTAAAAATTATGCTAAGAGCACTAAGATTCTACTAGAAGATAGATCTTGTTGAAGAAATGATAATGAAAAGTGTAGAATTGAAAGG
AGGTAATTTGAGATTGCGAAATCAAAGCTAAGAATTGGGATTATTTATTCTGGAAACTGCTAAATTTAGATTTCTTATAATACTATTTCAGTAAAAGTCATTTCGGTTTTCTGAAAGAGA
AATGAGATTGAAATTGGATCGTAGCCAATTATTCTTTTACAGAATTGATATTGTAAATTTGTGATTCTATTTTGAACTATCTCACGAATTATCTTACAACTGAAATAAAAAAGATCGAAT
GTAATTTAAATTCATTCATAACTATAATAGTTTTGAAAATTTATTTTCAGCTATCTAAAGTATATTTTTATCTGTCTTGTTTATTCGAATATACATATATAACGACGATAAAACTTTTAT
TCAATAAATTAATTCAATTGTATCGATATGTTGAATGATACAAAAAAATTTAATAAATTCTAATAATTTACTATTCACATCCATAGTAAAATATCAGAATAAAGTTCAATAAGATTTCTT
ATTTATATACATCGTGTATAAAAAAATGTTTATGTCTTTTCGAAGATATGATATAATTTATCATAATTTAAGGACAATCGCAATTTTTCCTTTTCACGTGTATCTCAAGACCATATAAAG
TAGCTATAAATATTCTACGCAACTGACTTTGTGTACAGTATGAAGATCGAAGTAAAGAAGAAGAAAAAAAAAAAATTACCGATCATTTTATGTTGTTCAAACATTTCTTCTATATATCTT
ATAATATCTTATAACAACTACGTAATTGTTTGTTAATGAACTATTGTTTGGTATTATATCAACAGCATTATTGTCAGCAATTATTATGATAATGATTTTATCCAGGCGTTGAAAATACAC
CGACACTCGATTTCTGTATTTTAAATTGACAAAAAAATTATAGACAGGTGAAAAATAAATAAGAAAAAAAAAGAAAAGAAAAAGAAGAGATATATCGTTTAATAAACGATGAATATAATG
AATATTGATGTATGTATACACGCATACATTATAACTTGAAAATGTGTGATGCGATAGAACGAAGGCGCCATCAATTTGCGATCGTTTCTTGCGTACGAAGCAAAATTAAATTAAAGCCGA
GGGAATATTAAGAGCGCAGAATTTCTCGTAAACAATCGAACTACGTAATATTGAAAATCACGTGGTACGAAACGAATGCACGACATGTGTACTTATAAAAGAAGTTTTACGCAAATTTAC
AACATTTTGCTGATAATTGAAAAAATTGAATAATCCTGAAAATGTTGTTCTCGATTATAAGTGAGAAATTGTGTCTTTTTTTTTAGAAACGAGCATAATAATCTGATCTATCGATTTAAT
ATATATTGATGAAAAGAATAATTGCTTGACAATCCAAGCAACGATTTAACTTATTCGTTAATGTTTTTTTTTTTTATTATTTAAAATTTCGCTAAAAGATAGCGAAAAATGTTGAAGTTA
ATTATTTTTTAACTTTGAATGAATTGAATGAAGTTCGTCGAACTTTGTTTGTTTCGATATCCAAAGTAATATTTGTTACTTAAAAATGTTTATTTGAAATTGCCTGTAAATTGACATAAT
TTTGAAATCAAATCTTACGTATTTTGATAAGTATTAAGAAATTTGTTGGGTTCAATAGAATCTAATGTTTTATATGTCGCAAGAAATGTTTTCTATGATTTCGTCTAAGTGAAAAATATG
TTTTATAATCAATTAGACGAAATAGCGAATAAAAAATAAGGTATTACATTATTTATGATAACAAATGATATATGAAATATTTCAAAATACTGTTTTCTAAACGTTTAAACATTATTTATA
ATCGTACGAGTAAATAGTAATGAGATACGATAAATAATAAGTAAAATTGTATAATAATAAGTTGTTCTATGATATACTATTTTATACCTCTTTTTTAATTCGATGATTATATTTCTAGCT
TTATTGTGAAAATTAAGCAATTTTAAAAATCAATATTTTTCGAAAAAAATTTCACATCTCTGATCTCATTTTCACGAAATAAAAAAATGAAATTAAAGGTGAGAACAAATTTCAGATCAG
GTTTATCTAACTTTGACGCTCTCAAAAATTTATTTTCGATTTTTTAAACTTATTTCACATACTTTCCTGTTAATTATAAAAGAATTATAATCTCCTTTACTATCTACGTAGTATATAAGT
TAAATGCAAGATAAAATTAATAAAACCATTTGACGTTGTTACTATAAAAAAAAAAAAAAACAAAATTCTATAATTACATTAACTCTGAATTAAATTTATATCGTTGATAACCTTACTATC
AATGACGTCAATGTTTTTTCAAACTTCATTTCATTATCTTAAATGTGATGTGGAATGAACAATATCCTACAACCATAATTATTAGAATAATTTGAACGTTCAACACAATAACAATTTTGA
TTGTACATTAAATTTAAATTTTACCTAGAAAAATCTAAATGCATCTAAAAGATCCTAAATCATTTCAATCGAATATGATTGAAAAAGGAGATATGCAATTTTTATTTAAAATGAAATTAA
CAAATGAGAAAGTGTAAACGAAAATATATTATTTACAAATAATTAAAAATTTTTAACCAGAATAATTTATATTCGTTTTTTAATAATAAATCCTGATTTTATCTATATATACATATATCC
TTCTGTATATAAGTTGATGTGATGTATAAAAAAAAAAAAAAAGAAAAGAAAGGAAAAGAAAAGACAAGTCAAAATCTTACAAGAAGTTCTCCACGTAACGATTTCGATCGATTAATCATT
ACAATAAATCTCAAATCCTTTTGAATTATTGTACTAAACAAAAAGCACGTTGTTACGCGAAATGACTCAACTAACCACTTCAAGATAATAACAATTGCGTCGTAGTTTTTCGCGATAAAG
GAAATTCATTTCGATTAGTAGTTCTATAAGTACGTCGAATCAATTTAGTCAAAGAATTTAAGATTTTTAGAAGATAGAAAGCATATTATATAAAAAAAAAAAAAATTGTTTGATTCTGTG
CAGCTGGTGGCCTAATGGCAGGTTCCGTGGCTACCTTGGCGATCCTATGGGTCTCTCTACAAACCATGGGATTCCTTGGAAATACGCATACGATCGGTGCCTATAAATTGCCAATTTCCT
TGCAGAACTATCTTGCCAGTTATACAG
AGGTAAGTTGTCCTCATTTTTCCTCCATTTTATTATATTATTATTTTCTTTTTTTTATCTATCGAAGAAAATTTTAATCGCAGTGTGTTTGAT
GATAAGATTTTATCCTGGATTACTATCAATATACGGAGTTGAACGCTTATCAATGTTATAAATATTTTCTTTTAGAGTTTATATATATATATATACATGTTGCATTTTAATCCAGGATCA
AATACATCATCCTTTGATAAAAATCAATAAAAGTATTGTAAAAAAAAAGTAATGTAAATATATGCAATATTGCTTAACATTGTTTGTTGTGAATTGTATTTGTGAAAATATTATTGAAAC
TATAAATTAGAATTAGAAATATGTTTGATAATTTTCCAATGTTCAATTAAATTTCATATTTTCAAGAAAGAGAGAAACATGGAAGGAATGTTTACTTTTTTAAATAAGAATATTTTTAAT
TTTCAACTTATAATATTTTGATGCTTTTTATCAATATCTATGATTTGTTTTCCTATAATTTTCTTATATTATCTATATCCATACATTTTATATATAGATTTATACAATTGTCAAACATCC
ATTTCTAATTGATAATTATGAAATATCTAATATTTAATAATCATTTTATTTTTAAACGATATTTGAAATAAATAACGAACACAATTGTAACAAATACAAATTGTGTTCGCATCTTTATCA
TCTTGCAATTTGAAATTCTATTAAATTGCAACAACAAAAATTTCTACTCGTACTTCAAAATACTTATAACGACAATAATTTAATTTCTACATAATCTGAATGAAACACAATGAACAAACA
TTAAGAATTAAAACTCTTCTTCTTGTTTCAAAAATTTTCCAAAGAATACAATATTTTACCGATAAAAAAAAAAAAAAAATTCTTTCCACAACATTTATGCGTTTTCTTAATAAATAATAC
GCATACCACAATAATTATCCGTTATAAAATTGGAGAAGATATCTTAAACACGTAAATTTAGAAACATTAACAGTTGCAAATTTCTACTAAGAAATGGAGAAAGAAAGAGAAAGAAAATAA
TTATACGTACTTTTCCTCCTCCATGTATCTTTGTGCCTCGCACAAATTATTTTCAACAATTCGTACAGAAAAAAAAAAAAAAGAAACTTGAAAAAGGCTGCGATCCGTTAGATCCCGTGT
ACAACCCGGTTGAATTGATTGAATTCCTTTTTTACCGACGTTTTTAAAGGTATCCTTTCAGGTTTGCCGATGACAAACTACCCTTACGAGGGCGGCGTCGTAGACACGGGTCGTACCCAT
AATCGGCGTTACCCTCACATTGACGAGGCGGTCTTGAACAACTCGATCAGTTTCGCGCAAAGCTTGGTCGATCGTATGAGCACCCTCGAAAGGAATATCGCGAATGCTGGCGTCGAATTG
ATGGCTCACACGCCGGCTGGAAAACAATTCCTTGATTCATATCCTTCCGAGGATGCTTTCGAGAGAGGCCTCGACGCCATAGTGGCGATGAAAGCTTCGTCCTATCTCCTTCATCAGAGC
TGTCACAGGTAACATTACACCTCTTAGGTCAAAGGTCAATTTCTGATTAGCTGTTTACACACGTCTATATCAGGATGTTTCCTTTTTATTACCGGTGAAAAATGTCGCCTTTGGGATTAA
TTCAGCGTTTAAAAGTAAATCGAGGAAAATTTATATATTTGTATCTGAAATATATTTATTCCTATTTTAGGGATTAAGATTTTCTTTTAGGGGTTGCTTATTTTCGAACAAATTATTCAA
TTTCGATTATTTTGAAGATTGGTAATGGGAGTTTAGAAAATTAACGTAACAAAGTATTTTTTTTAATTACTGTTATTACGAATTCATTGGCGGACGATGCATGTTACTTTCGAACGCTGA
ATCTTTCTTTAAAGTGGATTATAAAAATAAAAAAAAGAATATTGTATTTAATATATCATCTGGAAAAATTGGAGGAAATTGTGCAAAAGGAAGATTCTTTTTTCAAAAAGGGAGATTTCC
AAATTTCATATTACTTAAACACTTGATGTTGAAATTGAATTTTAGTCTATTAACATTCATCTCTATATGTTCTCATCTAATTCTATTCAAAATGTAGACTTTCTATGTGAAATGCATAAT
AAAAAAAAAATTTTTATAAAAGTATTTACAATGGGAAAAATTCAATATACCGAAATAATTTTTCGTTCAATCAATTATCTACTTCGAATAAATAAATAGATACTTTTTGTTGTTTCTATT
TTTCTTGAAAACGAATCATATGACATGATAATGTTAAATATTATCATTATTTTGATTTATCTAAAAGGTTATAAAATGGTGCAATATTAGAACAAATATCAGAAATCTTATTCTTCGATT
AAGCAATTTTGATTTATAGATATTTCATTACAATTTTCGTACTAAAAAAAAAAACTATTAACTTGTAAATCTATTTGTTGCTTAAATTCTCGCTGTTTGCAAAATATCGATTGAATTTAT
TTTATTGTAATGTTTCGCCTATAATCAAACTAATAAAAATGCCTTTTTGCACAATGAGCAATTCGTTAAAAGAATTGTTTCCTACTGGGATATCAAAAGATGGTTAGAAGATTGTCACTT
ATGTAATTAAAATATTGTAATAATTACATTTTATTTATTATAAATATTTTAAAACCATCTTCTGAACTCCTAACAGTGCTTCATTCTCTAAAAATGTAAAATTCTACCTTCTATATTCTA
AAATTCACCAACTAATAATTCTTTCGAAATTTTTAATTGAATATTGACACAACAATTCTATGTTCAATCATTTATCATTTCCTATTTATTTTTTTTTAATTTCTACGTTACACGTTTAAA
TTTATATGACAAATGATCCTCAACTATCCTCAACTATATCATCTTTACACGACGAATGATTTTGTGTTTTAAAATATTATGGAGAATTATTCCTCGTGAAATTACCAACTTTGCATAAAA
TAAGATTTTATTTATTTAAAAATTTTATGAAACTAAATATTATATATTTTATATTTCATAAAATTTTTTACGAAGTCACTTTATTACGTTGCTTTAAATTTCTTGAATAAAAATAAGAAA
GAAATTATTTTCAAATTAAAAAAAAAAAAGAAAGAAAAAAAATATATATATATAAAGGTAATGTATGCAATTTAAAAAGTATTTAAAAAGATATAAATTTAAATTTTTATATTCTATATT
CCTATCTAATTTCTACCAACATAATTCAAACATCATTCAAAACACTTCAAGAGTGTTAAATTTATTGCTCCTCGTCACAATCACCGTTATATATTCGTTATACATTTCTTTTTTCATTAT
TAAAAGCATTCAATATTATCAACTTTATTATTTGCTTAAATATCTCATTGAAGATTATTGCCACTTCGAATACAATATCAACGTTTAACCAAGCAAATTGATCATACAAATTACTCTTGC
AAAAACTTAACTCGCGTGTTAGATCCACCTCTGAATTTATATTATACACAGAAGCACAAAATCTCTCTTGCCGCAAAAAAAATTGACAGCCTTAAATAATATATCCCATATATATATATA
TATATATATATATATATATATATATATATATATATATTCGTATGGTAGCATGTTGTCACCATCGATAGTAGTGAAACACGTGGGCGCCTGTTTACTGTTTCCGCCGCTACTCGTGATTCG
CAAGAAACATTTAATCGAATCGACCGATCGATATTTGTTACAGATTCGGGCTGGACAAAGACGATTGCGCTCGTTTCATATCGACCTTGTCGCTGGAGGGGACTCCGTTGAACTCGGCCT
GTCCGTCATCGCGGCACAAGGGGTGCAATTCTCTGGCCAAGTACCGAAACATCGACGGCAGTTGCAATAATGTCCAAAATCCAAGCTGGGGTAGTGCGATGACCGCGTACACCAGAATTC
TCTTCCCCCAGTATTTCGACGGTAAGGGTGTTTCCTACCGTGTGACGATCAGCAAAGAAAAGAAAAAGAAAAAGAAAAAGAAAAGGAAAAAGAAAGAAATTTTAAAGACAAATGACTTGT
CTACCATATTTCACTACAATCGTCCGTTTTAGAGAAATTCGCGAAAAAATTCGTCGACGGTCTACGGCTCGAAATTATTATCGTTTCGTTTCTCGCTGGGCACACTTCGGTTTTTTTTAT
CTCTCGCTCGTAGCGTAACGCGATACGCGTCGTTTGCTGTGTTTTTTACGCTCGGCTTTGGACGGAATCGGACATTCTGGACGGACGCAAGAAACGGAAGCGGCGAACGGGAAGAAGAAT
ATTATCGAGATACATTTGAACCCTCTATGTACCGTGTTGTTGTCGTTATTTGTGTGGAATAATAATCGTTCAATTATTTGCAGCCTCTGAACGCTCTTGGCGCTTCCTTCTTCTCCTTTT
CTCACGTATCCGTCCCCTCACTCCTCTGATTGTCGTTTGATATTTTTTTTTTTTTTCTTTTGTTGTACTAATTTCTTCTGGAAGGGAATGATTTCGTTTCTTTTCTTTTAACTTACGATT
TAGAACGGCCGATGATCCAAGGATATTATTTTGTCGATCACGTTTGTACGCGATTTTCTTGTGGAAAGAAAAGATTCCATCTATATTCTTATTCTTATGGGATATAGGATGTGTTTGATC
TGTTTTCATCTGTGTTGTGGAGATGTATTTTGTGTCCCACGTTCGATCATCTATTTTCTAATTCCGATTTCTGAATTCATTGAGAAGANNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNTTCCTCTCCAACGAATATATATATATATATATATATATATATATATATATATATATTCGCCTGAGAAGAAACCCTAACTTTTATCCCTAAGGATAGGGAACG
TTTTGCGATGAAAAAAAAAAAAAAAAGAAAGAACAAAACACCCTGTAAATACATAGATATATAGCGTGTATAGAACATTTCAAGTAAGATACATAGACCGTAACTTTCGAAGAAACGAGC
TCCAGAAAATACATTGCAAGAGCGTCAGAAACAACTGAGGATCGTTCGTTCGTGTTAAGCGCGAGCGATAAAGATAGAATATTACGAGAATGTGTAGGAGCTTCGGTAAATAAGCGAGCG
CAAGAGAGGGGGTTGAATAGAAAAGAGAGAGAGGATAGAGAGAATTCTGTAGTCCGTAAACGCGGTGCTCGTGTTCAGTCGTCTTCAGTCCAACTTGGATACGCTCCTCGGCTTGTCCTC
AGCAGCCAGTTTTCATAAACGTATCCGCGAAATATTTTTCCCACTTTGCCGTGAATTGAACCAAAGGTGAATGCACCTGTACGAGCAGATACTCCAACTAGAGTATCTATTCCAAGACTA
ACGAGTTCATTAACGAAACCGGTCTAATTTATTTGAAATTTCTATCAGAAGGAAAATCTTCTCCTTCTGTTTGATCAATCTCGTCTCAACTCAACGTGTGCGCGTCGAAATTAATAGGAA
AATTCGTAATTGGATGTGTCGATAAAACGGAAATAAACGTATCTAACCGCGAACATTGCTATTCCGCTTTTGCGTGCTGAGAATGTTTCTTATTGCACCAGTGGACAATAATCGCTGGGC
CTATACGATGCACGGATTGGAGAAGCCTATGGATCACGTGTCTGGTAATGTGCCTGCTAACTATATTTTAAATATTTACTCGTAATCAATGCCTTTTATTATCCGGTATCTTGACGCACA
CGTAAGATTTTCATGATTTTTATCATATAGAAGCAAACAAAGATTTTGTACATGTAAAATTTAAATATTCGTGCATTATTATATCTATATTAATTTTCTTTAATCCTTTAAATTATCCAA
AATTAAAATTAAAATTTAATTATTCTTTCCAAGTTTAAGCATCATTGTTAAAAAATAAAAGATAATTATATTATTGTAAGACGCGAGGAGTAAGACTAATAATGCCTAGAGATTTAATTT
TATTTTATCCTCGTGTTTTATTACAATGTTCGGTTCCGTTAATTTAGTTGGCCTACAAAATAACAGGCAGTAAAGAAAATAATATCATTTTCAATATTTCAATAAAAGCACACGTACTTA
AAATATTTATTTCCTACGATAAGTAAATCGTTTTGTAAATCGCTTGCTCGCAAACTAATACAATTTTTCTAACTTTTTTATTAAAAATAACAGTAATAAAATATGTATTATTTATCTCGA
TTATACATTCTAAACGAATTTTGTGAAAGTTAGAAAATAGAAAATTCGAGATATTTAATACTATATTTCAAATGTTATACTTTATTATTATTATTTATTATTCTTAGAATTTTATATTGA
TTTTTTTTTTTTTTTTACGATTTCTATACTCCAAGTATTTTCTCTAGTACAGTATCTTGTTACTGTTATGAAATATAGAATGTAGCTACTTATCTCTCAGAGTATTGTACTCGTTCACCT
CGTACTACTGCACTGGTAGATATATACGATATACCGCTTGAATATATAAATTTAATAATTTAATATTAATAACCAATTTATTTCTTATTCAAAGTACGGACATTAAAAGGAAAACAATAG
TTTTCAATTCTAAGGAAGAAATTTTAATTATGTAGTAATCTCAAAAATATTGAATTTTTAATTTTTATCGTAAAACTTTTTTATTCGAGTATGTTTATATCTAAATAGCAAGACAAGACA
AGTTGAAGACAATATTACGAAAGTAAATATTGAGACACACGTCCTGGGAATTCGACCGGTAATTTCCGAATCCAAACGAATTATTCTATACAACGTGTGCGTTCAAATTCTCACATCATA
CAGTGGAAAAAATTGTTAAATTAAATATTGAGTCAACTTTACGAAATCCACGGAATCGACAATTAAGATTGAAAGAAAATTGAGTATTTCATAGTGAAAAATTGAATTGAATGAGCTGAT
TACTTGTCTTTCTTGTCTCTATTGTTTCTCTTGCTTCTGAAAACATTACTTAAATTATTCGTATATATATTTGTATAAAAATACATAAGTTAAACGAAATTTGAAACTTTTATTGAAATT
TCAAATAAAAAAAAAAAAGAAAGAAAAAAAGAGGAAAAAATGTTGAGTACAAACAATAATATTGATTTTTCGTATCTGAAATGTTATCTAGGTCAAGATACTATTTTTTAAAACACTTAG
TCATTTATCAATATCTCGATTGCACTTATATTTATATGTATATAGTTATATAAATAACATACATATAAATAAAAATTTTTAAAAAAGATATCAATAACGAAATTGCATCGTATAATGCAA
AATATTCTAACATTATATTTAAACGTAGTATAATAGTGAATATGTATGTATATACAGTAGTTAGAAAGTGAATTTTCATATTGCCCTTGTTAGAAATATTTTAAAATTAAAATATCTTGT
CGTACTTTATCTACTGTACATTATTGATTGAAAAATGTGGTAGTGAAAAAATTTAAAAAATATTTTTGTGAACGATCAAATGATACGATAAATAAAAAAAAAAAATAAAATTTATTCAAA
AATTGAAATGGAAATTTTGATAAGTTATAAGTAATAAATTATTTTTTTAAACTAATATCATGCTATAATGGTGGATTTTGAGTCATTATTATTGTAGAAAATAATTTTAAAAATTCGTAG
AAATATACGATGTGTTTTTAATTACAGCTAATTTAATATTCTAATAATAATCATACAAGTGTTTGAATTAATAAAGATGAATTAATACATTGAAAAAAACATTTGCACTCCATATGCGTT
GTATATTCGTTTTTTTAGATTAATGTGGATTATACAAAAGAAACGAATAAAATTAAAGAATAATTAATAAGTTTATATAACTATAATATATATTAGAATATTAAATTCTAATATTAGCAT
CAGCAATATGATATTAATTTAAAAGTTAATTTAAATGATTTAAGAAAAATCTTGAATCAAATTAAAATTTGATTATGAAATGTAAACTAAGTAAACTAACTCTAACTTTTAATAATTCTA
AATTATCCGTTTATAAATTTTTTTATTCGAAAAAAAAACATTTTAGAAAATTGTAATTCTCACCATTTCTAATTTCAAATCTAAACCTCTTCTGGAATATTTTATAATATAATAAAATAA
AATTGAAAGATTACTCTTTATATTATTGGAATGGCCATTAAGCGTATTCGGTTTATTAAAGTGATGATTGTAATAACCGTTGTAACTTGAGCTACACCGTGATGTAACGAAACTCATCTT
CTTCATACTCGTAGAAAGGAGGCGTGAAAAATGCGCCTCTGTATTTTACAGCAGCAACATATGGCATTCATTTTATAAACACGTATCTCGATGAGACGTGCTGGCAAAAATCGAGTCATC
TGGTTAAAAAAAAAAAAAAAAAAAGTAGAAGAACGTCTACGTTTCCTTCGCACAATTGCATTTAACTGTAAATTCGCATTTTCATTTTTAAACAAATCACACCTTCGACACTATTTCCGT
TCTCACGAAGAGGTATTCCACAATCAGGATATGTAATGAATCATTCTCGTTAGACGCGACTAAATTTAAATACGATTACGCTCACTTTGTAACTTTGTTTCGAAAAAGAAGATTTATTGT
TTACGTTTGTAAAACCGAAAGATAGGATAGGAAGAGGATATTTTCATTTCTTATAAATATTTTCGATTTATATTCGAAAACAGAAACGATTAGATAATTTTACCGCTTTACGTTATATAG
TATAAGTCATGCATAGAAATTATTTTGAGACATTTATATTTAGAAATTGATACTCCAAATATGAAATTTCTCGAAATAATTTCTTCGTATATATTTTTATGTTATCATATTTCGTTGAAT
ATTGAATTGGATTTGTAATAATTAATGTAACTTAGTAATCTAAATTAATATAACTATACTAATCGAACTTATACTGCTACGATTTTCAACCTTCCATCAGATTAAAAATTATGCTAAGAG
CACTAAGATTCTACTAGAAGATAGATCTTGTTGAAGAAATGATAATGAAAAGTGTAGAATTGAAAGGAGGTAATTTGAGATTGCGAAATCAAAGCTAAGAATTGGGATTATTTATTCTGG
AAACTGCTAAATTTAGATTTCTTATAATACTATTTCAGTAAAAGTCATTTCGGTTTTCTGAAAGAGAAATGAGATTGAAATTGGATCGTAGCCAATTATTCTTTTACAGAATTGATATTG
TAAATTTGTGATTCTATTTTGAACTATCTCACGAATTATCTTACAAGTGAAATAAAAAAGATCGAATGTAATTTAAATTCATTCATAACTATAATAGTTTTGAAAATTTATTTTCAGCTA
TCTAAAGTATATTTTTATCTGTCTTGTTTATTCGAATATACATATATAACGACGATAAAACTTTTATTCAATAAATTGATTCAATCGTATCGATATGTTGAATGATACAAAAAAATTTAA
TAAATTCTAATAATTTACTATTCACATCCATAGTAAAATATCAGAATAAAGTTCAATAAGATTTCTTATTTATATACATCGTGTACAAAAAAATGTTTATGTCTTTTCGAAGATATAAAC
ATGATATAATTTATCATAATTTAAGGACAATCGCAATTTTTCCTTTTCACGTGTACCTCAAGACCATATAAAGTAGCTATAAATATTCTACGCAACTGACTTTGTGTACAGTATGAAGAT
CGAAGTAAAGAAGAAGAAAAAAAAAGAAAAAAAAATTACCGATCATTTTATGTTGTTCAAACATTTCTTCTATATATCTTATAATATCTTATAACAACTACGTAATTGTTTGTTAATGAA
CTATTGTTTGGTATTATATCAACAGCATTATTGTCAGCAATTATTATGATAATGATTTTATCCAAGGCGTTGAAAATTACACCGACACTCGATTTCTGTATTTTTAAATTGACAAAAAAA
ATTATAAGACAGGTGAAAAATAAATAAGAAAAAAAAAAGAAAAAGAAAAAGAAGAGATATATCGTTTAATAAACGATGAATATAATGAATATTGATGTATGTATACACGCATACATTATA
ACTTGAAAATGTGTGATGCGATAGAACGAAGGCGCCATCAATTTGCGATCGTTTCTTGCGTACGAAGCAAAATTAAATTAAAGCCGAGGGAATATTAAGAGCGCAGAATTTCTCGTAAAC
AATCGAACTACGTAATATTGAAAATCACGTGGTACGAAACGAATGCACGACATGTGTTCTTATAAAAGAAGTTTTATGCAAATTTACAACATTTTGCTGATAATTGAAAAAATTGAATAA
TCCTGAAAATGTTGTTTTCGATTATAAGTGAGAAATTGAGTCTTTTTTTTAGAAACGAGCATAATAATCTGATCTATCGATTTAATGTATATTGATGAAAAGAATAATTGCTTGACAATC
CAAGCAACGATTTAACTTATTCATTAATGTTTTTTTTTTTCATTATTTAAAATTTCGCTAAAAGATAGCGAAAAATGTTGAAGTTAATTATTTTTTAACTTTGAATGAATTGAATGAAGT
TCGTCGAACTTTGTTTGTTTCGATATCCAAAGTAATATTTGTTACTTAAAAATGTTTATTTGAAATTGCCTGTAAATTGACATAATTTTGAAATCAAATCTTACATATTTTGATAAGTAT
TAAGAAATTTGTTGGGTTCAATAGAATCTAATGTTTTATATGTCGCAAGAAATGTTTTCTATGATTTCGTCTAAGTGAAAAATATGTTTTATAATCAATTAGACGAAATAGCGAATAAAA
AATAAGGTATTACATTATTTATGATAACAAATGATATATGAAATATTTCAAAATACTGTTTTCTAAACGTTTAAACATTATTTATAATCGTACGAGTAAATAGTAATGAGATACGATAAA
TAATAAGTAAAATTGTATAATAATAAGTTGTTCTATGATATACTATTTTATACCTCTTTTTCAATTCGATGATTATATTTCTAGCTTTATTGTGAAAATTAAGCAATTTTAAAGATCAAT
ATTTTTCGAAAAAATTTTCACATCTCTGATCTCATTTTCACGAAATAAAAAAATGAAATTAAAGGTGGGAACAAATTTCAGATCAGGTTTATCTAATTTTGATGCTCTCAAAAATTTATT
TTCGATTTTTTAAACTTATTTCACATACTTTCCTGTTAATTATAAAAGAATTATAATCTCCTTTACTATCTACGTAGTATATAAGTTAAATGCAAGATAAAATTAATAAAACCATTTGAC
GATGTCACTGTAAAAAAAAAAACAAAATTCTATAATTACATTAACTCTGAATTAAATTTATATCGTTGATAACCTTACTATCAATGACGTCAATGTTTTTTCAAACTTCATTTCATTATC
TTAAATGTGATGTGGAATGAACAATATCCTACAACCATAATTATTAGAATAATTTGAACGTTCAATACAATAACAATTTTGATTGTACATTAAATTTAAATTCCAGAAAGATCTAAATGC
ATCTAAAGATCCTAAATCATTTCAATCGAATATGATTGAAAAAGGAGATATGCAATTTTTATTTAAAATGAAATTAACAAATGAGAAAGTGTAAATGAAGATATATTATTTACAAATAAT
AATTTAAAAATTTTTAACCAGAATAATTTATATTCGTTTTTTAATAATAAATCTTGATTTTATCTATATATACATGTATCCTCCTGTATATATAAGTTGATGTGATGTATAAAAAAAAAA
AAAGAAAAGAAAGGAAAAGAAAAGACAAGTCAAAATCTTACAAGTTCTCCACGTAACGATTTCGATCGATTAATCATTACAATAAATCTCAAATCTTTTTGAATTATTGTACTAAACAAA
AAGCACGTTGTTACGCGAAATGACTCAACTAACCACTTCAAGATAATAACAATTGCGTCGTAGTTTTTCGCGATAAAGGAAATTCATTTCGATTAGTAGTTCTATAAGTACGTCGAATCA
ATTTAGTCAAAGAATTTAAGATTTTTAGAAGATAGAAAGCATATTATATAAAAAAAAAAAAAAATTGTTTGATTCTGTGCAGCTGGTGGCCTAATGGCAGGTTCCGTGGCTACCTTGGCG
ATCCTATGGGTCTCTCTACAAACCATGGGATTCCTTGGAAATACGCATACGATCGGTGCCTATAAATTGCCAATTTCCTTGCAGAACTATCTTGCCAGTTATACAGGTAAGTTGTCCTCA
TTTTTCCTCTATTTTATTATATTATTGTTTTCTTTTTTTTTATCTATCGAAGAAAATTTTAATCGCAGTGTGTTTGATGATAAGATTTTATCCTGGATTATTATCAATATATGGAGTTGA
ACGCTTATCAATGTTATAAATATTTTCTTTTAGAGTTTATATATATATATATACATGTTGTATTTTAATCCAGGATCAAATATATCATCCTTTGATAAAAATCAATAAAAGTATTGTAAA
AAAAAAAGTAATGTAAATATATGCAATATTGCTTAACATTGTTTGTTGTGAATTGTATTTGTGAAAATATTATTGAAACTATAAATTAGAATTAGAAATATGTTTGATAATTTTCCAATG
TTCAATTAAATTTCACATTTTCAAGAAAGAGAGAAACATGGAAGGAATGTTTACTTTTTTAAATAAAAATATTTTTAATTTTCAATTTATATTTAATATTTGGATGCTTTTTATCAATAT
TTATGATTTGTTTTCCTATAATTTTCTTATATCATCTATATCCATACATTTTATATATAGATTTATACAATTGTCAAACATCCATTTCTAATTGATAATTATGAAATATCTAATATTTAA
TAATCATTTTATTTTTAAACGATATTTGAAATAAATAACGAACACAATTGTAACAAATACAAATTGTGTTCGCATCTTTATCATCTTGCAATTTGAAATTCTATTAAACTGCAACAACAA
AAATTTCTACTCTTACTTCAAAATACTTATAACGATAATAATTTAATTTCTACATAATCTGAATGAAACACAATGAACAAACATTAAGAATTAAAACTCTTCTTCTTGTTTCAAAAATTT
TCCAAAGAATACAATATTTTACCGATAAAAAAAAAAGATTCTTTCCACAACATTTATGCGTTTTCTTAATAAATACCACAGTTTAAATAATTATCCGTTATAAAATTGGAGAAGATATCT
TAAACACGTAAATTTAGAAACATTAATAGTTGCAAATTTCTACTAAGAAATGGAGAAAGAAAGAGAAAGAAAATAATTATACGTACTTTTCCTCCTCCATGTATCTTTGTGCCTCGCACA
AATTGTTTTCAACAATTCGTACAGAAAAAAAAAAAAAAAAAAAGAAAGAAACTTGAAAAAGGCTGCGATCCGTTAGATCCCGTGTACAACCCGGTTGAATTGATTGAATTCCTTTTTTAC
CGACGTTTTTAAAGGTATCCTTTCAGGTTTGCCGATGACAAACTACCCTTACGAGGGCGGCGTCGTAGACACGGGTCGTACCCATAATCGGCGTTACCCTCACATTGACGAGGCGGTCTT
GAACAACTCGATCAGTTTCGCGCAAAGCTTGGTCGATCGTATGAGCACCCTCGAAAGGAATATCGCGAATGCTGGCGTCGAATTGATGGCTCACACGCCGGCTGGAAAACAATTCCTTGA
TTCATATCCTTCCGAGGATGCTTTCGAGAGAGGCCTCGACGCCATAGTGGCGATGAAAGCTTCGTCCTATCTCCTTCATCAGAGCTGTCACAG
AGGTAACATTACACCTCTTAGGTCAAA
GGTCAATTTCTGATTAGCTGTTTACACACGTCTATATCAGGATGTTTTCCTTATTATATCCGGTGAAAAATATCGCCTTTGGGATTAATTCAGCGTTTAAAAGTAAATCGAGGAAAATTT
ATATATTTGTATCTGAAATATATTTATTCCTATTTTAGGGATTAAGATTTTCTTTTAGGGGTTGCTTATTTTCGAACAAATTATTCAATTTCGATTATTTTGAAGATTGGTAATGGGAGT
TTAAAAAATTAACGTAACAAAGTATTTTTTTTTAATTACTGTTATTACGAATTCATTGGCGGACGATGCACGTTACTTTCGAACGCTGAATCTTTCTTTAAAGTGGATTTCGTTTATAAA
AAAAGAATATTTAATATATCATCTGGAAAAATTGGAGGAAATTGTGCAAAAGGAAGATTCTTTTTTTCAAAAAGGGAGATTTCCAAATTTCATATTACTTAAACACTTGATGTTGAAATT
GAATTTTAGTCTATTAATATTCATCTATATACGTTCTCATCTAATTCTATTCAATATATGGACTTTCTATGTGAAATGCATAATAAAAAAAAAAATTTTTTATAAAAGTATTTACAATGG
GAAAAATTCAATACACCGAAATAATTTTTCGTTCAATCAATTATCTACTTCGAGTAAATAAATAGATACTTTTTGTTGTTTCTATTTTTCTTGTAAACGAATCATATGACACGATAATGT
TAAATATTATCATTATTTTGATTATTTATCTAAAAGGTTATAAAGTGGTGCAATATTAGAACAAATAGAAACTCGAAATCTTATTCTTCGATTAAGCAATTTTGATTTATAGATATTTCA
TTATAATTTTCGTACTAAAAAAAAACTATTAACTTGTAAATCTATTTGTTGCTTAAACTTTCGATGAAAATTCTTGCTGTGTTTGCAAAATATCGATTGAATTTATTTTATTGTAATGTT
TTGAGCCTATAATCAAACTAATAAAAATGCCTTTTTGCACAATGAGCAATTCGTTAAAAGAATTGTTTCCTATTGGGATATCAAAAGATGGTTAGAAGATTGTAATTAAAATATTGTAAT
AATTATATTTTATTTATTATAAATATTTTGAAACCATCTTCTGAACTCCTAACAGTGCTTCATTCTCTAAAAATGTAAAATTCTACCTTCTATATTCTAAAATTCACCAACTAATAATTC
TTTCGAAATTTTTTAATTGAATATTGACACAACAATTCTATGTTCAATCATTTATCATTTCCTATTTATTTTTTTTTAATTTCTACACGTTTAAATTTATATGACAAATGATCCTCAACT
ATGTCATCTTTACACGACGAATGATTTTGTGTTTTAAAATATTATGGAGAATTATTCCTCGTGAAATTACCAACTTTGCATAAAATAAGATTTTATTTATTTAAAAATTTTATGAAACTA
AATATTATATATTTTATATTTCATAAAATTTTTTACGAAGTCACTTTATTACGTTGCTTTAAATTTCTTGAATAAAAATAAGAAAGAAATTATTTTCAAATTAAAAAAAGAAAGAAAATA
TATATATATAAAGGTAATGTATGCAATTTAAAAAGTATTTAAAAAGATATAAATTTAAATTTTTATATTCTATATTCCTATCTAATTTCTACCAACATAATTCAAACATCATTCAAAACA
CTTCAAGAGTGTTAAATTTATTGCTCCTCGTCACAATCACCGTTATATATTCGTTATACATTTCTTTTTTCATTATTAAAAGCATTCAATATTATCAACTTTATTATTTGCTACTTAAAT
ATCTCATTGAAGATTATTGCCACTTCGAATACAATATCAACGCTTAACCAAGCAAATTGATCATACAAATTACTCTTGCAAAAACTTAACTCGCGTGTTAGATCCACCTCTGAATTTATA
TTATACACAGAAGCACAAAATCTCTCTTGCCGCAAAAAAAATTGACAGCCTTAAATAATATATCCCATATATATATATATATATATTCGTATGGTAGCATGTTGTCACCATCGATAGTAN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNAAAAAAATTGACAGCCTTAAATAATATATCCCATATATATATATATATA
TATATATATTCGTATGGTAGCATGTTGTCACCATCGATAGTAGTGAAACACGTGGGCGCCTGTTTACTGTTTCCGCCGCTACTCGTGATTCGCAAGAAACATTTAATCGAATCGACCGAT
CGATATTTGTTACAGATTCGGGCTGGACCCCCCCCACCGCGCTCGTTTCATATCGACCTTGTCGCTGGAGGGGACTCCGTTGAACTCGACCTGTCCGTCATCGCGGCACAAGGGGTGCAA
TTCTCTGGCCAAGTACCGAAACATCGACGGCAGTTGCAATAATGTCCAAAATCCAAGCTGGGGTAGTGCGATGACCGCGTACACCAGAATTCTCTTCCCCCAGTATTTCGACG
CGGTAAG
GGTGTTTCCTACCGTGTGACGATCAGCAAAGAAAAGAAAAAGAAAAAGAAAAAGAAAAGGAAAAAGAAAGAAATTTTAAAGACAAATGACTTGTCTACCATATTTCACTACAATCGTCCG
TTTTAGAGAAATTCGCGAAAAAATTCGTCGACGGTCTACGGCTCGAAATCATTATTATCGTTTCGTTTCTCGCTGGGCACACTTCGGTTTTTTTTATCTCTCGCTCGTAGCGTAACGCGA
TACGCGTCGTTTGCTGTGTTTTTTACGCTCGGCTTTGGACGGAATCGGACATTCTGGACGGACGCAAGAAACGGAAGCGGCGAACGGGAAGAAGAATATTATCGAGATACATTTGAACCC
TCTATGTACCGTGTTGTTGTCGTTATTTGTGTGGAATAATAATCGTTCAATTATTTGCAGCCTCTGAACGCTCTTGGCGCTTCCTTCTTCTCCTTTTCTCACGTATCCGTCCCCTCACTC
CTCGTCTGATTTTTTTTTTCTTTTGTTGTACTAATGCAATTTCTTCTGGAAGGGAATGAATTTCGTTTCTTTTCTTTTCTCTAATTTACGATTTAGAACGGCCGATGATCCAAGGATATT
TTGTCGATCACGTTTGTACGCGATTTTCTTGCGGAAAGAAAAGATTCTATCTATATTCTTATTCTTATGGGATATAGGATGTGTTTGATCTGTTTTCATCTGTGCTGTGGAGATGTATTT
TGTGTCCCACGTTCGATCATCTATTTTCTAATTCCGATTTCTGAATTCATTGAGAAGAGTAATAAGAGATTGGTAATAATTTTTTGGTTGTTGCATTATTAATACAGGGTGTCCTAGAAA
TACGTAATACTTTCGATTAACATATATTATATATTAATTTGCCAAGTAATATTCTGCAAATGCAACCAGAAATTGAATATGGATTGTCCTCTTGGTAAAATTTATTAAAGAAAAGAATTA
TCGTTGAAAAAGTTGTTTTTCGATGACTAATTCTTTTTATTCTGTCTGTTTTTACACTTGAATAAACTTACACTTCTTCTCAGTACAAAATGTTTCACGTTTAGATAAAAAAGATTATTA
ATAATATCGAAAATATTTGAAACGGAAATGTTTATCGAATAACATTATCGAATGAAAATATTCTTTTTCTAAAAAATTTTTATTCCTTAAATTATACGAAACATGTGAAAAATTTAAAGT
AGGCTAAATAATTCCAAGTATATTTCTGACTCACACGCCTGCATATGTATGTTTCTAAATACCTAAGAATATTACTGAAACGATAAATAGTACGATAAATTTTTTTTTTTTAAATGGAGA
TTTAAGTACTTTGTGTCTCGTATGTAAAGCAGCGTGCTGTATTTATGCAGAATAATAATTCAAGGACATCGATTCATATACATTTCTCTATGCATACAAGCATATTCTAATTTTATTTTA
CTTTTACTTTTTACGTACATAATTGAAAAATTGAAATATCAAATATCGTACGAATCATTCTTTTCATATTAATCCTAGGACACTCTGTAATTACATTGTATTCCGTTACACGATGAATTA
AAAATGAAAAAGAATCCTTCAGTTTCAATCTAACTCTATCTAAGTCTATTCGATTATACACATCTTTGATCAGGTTTTTCTTTAATCGTTCATTTTCGAACAAATTTGATTCACAACGAG
TCATCATCACACTGTCGGAGTTACATTATTTTTTTTAAAAATTCTTCGTCTCCCTCGTCGGCCGTTGATTATATTTAACGAAAATATTCCGCAAAATATCCGATAAGGAAAGAAAGAAAC
TTTTCTCGAAGAACGAAAATATAAAATGATTCTTTCATATTCATGATTCGATGATGGTATAAGCGAGTTACCAGCACAGCCTCGACCTACTAACCCACCTCTACTACTCCTCATATCGAC
ACCTCGCAAAAGTATATACGATCACACACGACACGCAGAAGAAAAAAAAATATATATCACACACGTTTGTCACACAACAGGCCGAAATACACAATTGTTATACGTTGTACACAATGTATT
CTAGTGCTACCAAGTTCAAAAATTTACCTATTCACTTCTGATACTTGAAAAGATTTTATTGATTTATCTTAACATTTTTTTCTACTTTATATATTTCATCCTCGATTCGTTCGATAATTA
CATCTTGTTGTAGTATCAATTTGCAAAATTGATACGATCTTATCTTTCCTTATTGTATCCTCAATTTTTTTATTAATCGTTTCAGATTAATTCTGAAATAATAGCCATTACAATCGTCGA
ATATTTAAAAACGTCACGTCACGTTCAAAACATAAATTTATTCTTCCATTCTTCTATAAAAATTTCTTTTATACACAGATGATATATATATATATATATTTCTTCCCGACGAGCAAGTAG
TTTTCAAAATCGATACGATATCAATATATACTACATTTTGTACTACCTGTCTGTGTTACGTACACGTACAAAAAAAAAAAAACGAACACACTCTCTTATCCTTGGGCGCTAATGGACACA
CAAAAAAAAAAAAAAAAAAAAAACGACGTTCGTCGATTGGCTTAACAAATTATATTCTGTGATTTGCATTACAGTTGTTGTGCGATAAGGCACATAAGAGCATAAAATGCCTGAGTGTAG
CAGTGAATAATACTGCCTACAATAGGGTGCCCCGGTCGGGAGATTCTATCCAGCAGTAGAATGTGTGTATGTAAACTAATTCGGATATATCTAATAATGTATCATATTTATATATATTAT
ATATATATTGTAACACACTAGTTCAAATATTTTTTCTGTTGATTGCGGTATACGGGTCTCGTTAAAGGTGTCCGAGGTAAGCGAATGAAAATTGGGAGTCATTCGCGACGATTCCAATTA
TCTTTTTTTTTTTTAAATCCGTTCTTCAAATCTTCGTTTTTTGTTTCTTTATATACGTATATGCATTTATACAAGCAGTTGTATATCATCAAGCATCCATCATCTCCCAATTTGATTTTC
TCACTATTGGGCACCTTCATCAGCCACATAGATAAGTCACTTGATCCCTTCTGTAAGCGTTCTCGACGTGATTCTTCCTTTTTCAATTCATCATTGCATCCATCTTGTGGTAAATTAGAA
TAGAATGTGAATTAAAAAAAAAAAAAAAGAACGAGAAAATAATAATCCGTTCTCAAGCGTCGATAACGCATCAGAATATCACGTCAAAAAAAAAAAAATAAGTAGAAGACAAGTATTTTG
TACTGCTCTGCAGCGCGAGAGTCGTCGTCGTCGTTTCGTTCGGTCGATTCAGAGATCAATCAGCGTATTCAGAAAAAAGAAAAATAGAAAGAAAAAGAAGAAGAAAAGAAAAACTTTAAT
TCGAAAAGCAATCATCGTCGCTGAAATTTTAACTCACTTTAAATATGTCATTTACTGATTGATCTCTGATGAATTTCGCGTGCTGAGGCAGGTTTTATAGGATAGGATCCTCGTATTGCA
GGGATTGGAAACCTCGATTCCAATTGATTCAGTATCGCGAACTGTTTCTCGCTCTCGCGCTGCACCAACATTATTTCACACGCATACGCGGAGATCACCTGCAAAAAATATTGTCGAAAT
CGGAGTAATGATGATCTTTCCAAACCTTTCTCTCTTCGAGTTTGATCATGAACTATTTAACAAAAAATTCTTAAATATCGTCGTTTCAATTTTTCCAATCGTTGAGAAATCGAATATTAC
GAATATTACTCCGATTAGGCGACGAGAGGTGTCACGAGGTAACGTAACGCGGGCCTAATGCTTAATTTGGCGATCAGGGATCCAAGAACCGAGGCGTATGGGGCACACGAGAAAGCCGCT
ACCCGGCGCAAGAAGCATAAGCGTGGCCGTGTCGACGCCCAACGATCAGTCGGACGTCAGCAGAACTTTGACGGTGATGCAGTGGGGCCAGTTCGTTGCGAACGACATTTCTTACACCCC
CATGCGCAAAATGG
GGGTAAGCGTTTTCTTTTCAAAGTTGAAAAAGATTATTATACACGCGTGACAATATGACACGTATTCTTTCGAATTAAATATTTGCAATGAAAATTCATTTTCATC
GATATGTATTACGATCCTTGTGCAAATAATTATAAAATTATTGCAGTGTCGACAGGAAAGCCGATCTCGTGCTGTCGATCAGACGGAAACACCTTATCGCCTAGATACGTACACCCTGAT
TGTTCCGTAATTATGGTACCTGATCGAGATCCTATTTACGGGCAGCATTACGTACGATGCATGAATTACGTGCGATCGTTGCCCGTCCTTAAAGCGGAATGTACGTTTGGACCCGCGGAA
CAG
AGGTATATATTTTTCATTTCTTTTATTTCCTTTAATATGAATGATAAAAAAATTTGAAAGAAAAGAATAGGGTTGTTAGAATCAAGTCTTTAATCGATTTTTTCGACGACAGATGAA
TCAAGCGAGCCACTTTTTGGACGGTTCGGCGATCTACGGTTCTACGTTGAAAAAATCCCGTCAACTGCGCGAGTTCGAAGGGGGTCGCTTACGAGTTCACAAGGAGAGTAACCACGAATT
CTTGCCGATCGGGGAGGATGAAATCTCGTCCGCGTGCGCGAAAAACTGTTACAATTCTG
TGGTGAGCATTTTCCTACTCTCGATTTGCAATCGACCACGGAAAGAATAAAATCTTTAAAA
TATTTTATCCTCTTTTTTCGTAAATGATGATTCGAGCATTAAATTAAAAGACGCATTTTTCTTCGTCCCCTCTCCCCAAGTTTCATTCCAAGTTTCAATCTAAATTTCATATTTCATATA
TTATATATTTATCATATTTCATTTATTATATATTTCAAATTTCATATATATACTCTTAATTGGTCAGGCGATTATCGCGTAAACACGCATCCACAACTCGCTGTGATACACACGATCTGG
CATCGCGAGCACAACCGAATAGCCGACAAACTCGCCGAGCTGAATCCAAACTGGTCGGACGAGACGCTGTTCCAAGAGGCTAGGCGCATAGTTATTGCTGAAATTCAGCATATCACGTAC
AAGGAGTGGCTACCTATATTGCTGGGCAAGAGGTACACCCGCGCCGTTGGTCTCACAGTTGGCAACAGCTACAGTCGTAATTACAATTCCGAGGATGATCCAGCGATCAGCAACGAGGTC
GCGACTGCGGCTCTCCGCTTCTTGACTTCTTTGATGCAAGGAAAAATAAG
AGGTAAATTTATTTTTTCATTCTATGTGACGTATATACAAAATGAAAAATATGTATCTTCAATTTTGTTA
TTTTTATGATTCTGTGTTTGTACAGTTTGACAGACGACAAACGCCAGATCAACAAAACGGTTTCCTTGTCGGAATACTTCTTCAAACCGATTATAATCGAGTCTGACGAAGTGTTCGACG
GTTTGTTACGCGGGATGGCCACTCAGACCAGCCAGAAAATGGATGTCAGCATAATCGAAGACGTAACGAGCAAGTTATTCGCCGCGGGTCAAGATAGCTTAGGCTTGGACGCGATCAGCT
TGGACATTCAACGTGGTCGTGATCATGGCCTGCCAGGTTACAATCATTACAGAAAGTATTGCGGTCTTCCAATTGCGAACACCTTCGATGATTTCTTGGATTACATTTCAGTGGAG
AGGT
AAAAATTATTTCGAGTATATACGATGATTTAATTGGACGTATTTTTCATACATCGAATTAATAATAACTATTATCATTAAAATTCATTGTTTGAAAAGAAATATTTTTCCAAATTATTTT
TATAATCCAAAATTTAATCAATTAACAGATGATGAAGAAATTGCGCGCACTTTACGCTCATCCCGATGACGTAGACCTTATTATCGGGGGTATGGCCGAGAGGCCAGTGGATGATGGCCT
ATTAGGACCCACCTTCCGCTGTTTAATATTTGAACAGTTTTCGAGAACCCGTCGCACCGACAGATATTTCTACGATTCTGCGTATCAACCGCATCCCTTCACACCCG
CGGTAAGAGAATA
CATTAAAGAATTGACATTTATATTTGGAAATATTGATATAAGTTTTAAGAGTACAAATTGTAACTTTGTGTTGAACAGAGCAATTGGCACAAATACGCAATGTAACGTTGGCAAGAATAT
TTTGCGACAATGGTAACAATATTACCCAAATGCAACCGAACGTATTTCTCCGGCCACAAGCAGAGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTTTCTTATTGCACCAGTGGACAATAATCGCTGGGCCTATACGATGCACGGATTGGAGAAGCCTATGGATCACGTGTCTGCTGGTGGCCTAATGGCAGGTTCCGTGGCTACCTTGGCG
ATCCTATGGGTCTCTCTACAAACCATGGGATTCCTTGGAAATACGCATACGATCGGTGCCTATAAATTGCCAATTTCCTTGCAGAACTATCTTGCCAGTTATACAG
GTTTGCCGATGACA
AACTACCCTTACGAGGGCGGCGTCGTAGACACGGGTCGTACCCATAATCGGCGTTACCCTCACATTGACGAGGCGGTCTTGAACAACTCGATCAGTTTCGCGCAAAGCTTGGTCGATCGT
ATGAGCACCCTCGAAAGGAATATCGCGAATGCTGGCGTCGAATTGATGGCTCACACGCCGGCTGGAAAACAATTCCTTGATTCATATCCTTCCGAGGATGCTTTCGAGAGAGGCCTCGAC
GCCATAGTGGCGATGAAAGCTTCGTCCTATCTCCTTCATCAGAGCTGTCACAG
ATTCGGGCTGGACCCCCCCCACCGCGCTCGTTTCATATCGACCTTGTCGCTGGAGGGGACTCCGTTG
AACTCGACCTGTCCGTCATCGCGGCACAAGGGGTGCAATTCTCTGGCCAAGTACCGAAACATCGACGGCAGTTGCAATAATGTCCAAAATCCAAGCTGGGGTAGTGCGATGACCGCGTAC
ACCAGAATTCTCTTCCCCCAGTATTTCGACG
GGTGCCCCGGTCGGGAGATTCTATCCAGCAGTAGAATGTGGATCCAAGAACCGAGGCGTATGGGGCACACGAGAAAGCCGCTACCCGGC
GCAAGAAGCATAAGCGTGGCCGTGTCGACGCCCAACGATCAGTCGGACGTCAGCAGAACTTTGACGGTGATGCAGTGGGGCCAGTTCGTTGCGAACGACATTTCTTACACCCCCATGCGC
AAAATGG
TGTCGACAGGAAAGCCGATCTCGTGCTGTCGATCAGACGGAAACACCTTATCGCCTAGATACGTACACCCTGATTGTTCCGTAATTATGGTACCTGATCGAGATCCTATTTAC
GGGCAGCATTACGTACGATGCATGAATTACGTGCGATCGTTGCCCGTCCTTAAAGCGGAATGTACGTTTGGACCCGCGGAACAG
ATGAATCAAGCGAGCCACTTTTTGGACGGTTCGGCG
ATCTACGGTTCTACGTTGAAAAAATCCCGTCAACTGCGCGAGTTCGAAGGGGGTCGCTTACGAGTTCACAAGGAGAGTAACCACGAATTCTTGCCGATCGGGGAGGATGAAATCTCGTCC
GCGTGCGCGAAAAACTGTTACAATTCTG
GCGATTATCGCGTAAACACGCATCCACAACTCGCTGTGATACACACGATCTGGCATCGCGAGCACAACCGAATAGCCGACAAACTCGCCGAG
CTGAATCCAAACTGGTCGGACGAGACGCTGTTCCAAGAGGCTAGGCGCATAGTTATTGCTGAAATTCAGCATATCACGTACAAGGAGTGGCTACCTATATTGCTGGGCAAGAGGTACACC
CGCGCCGTTGGTCTCACAGTTGGCAACAGCTACAGTCGTAATTACAATTCCGAGGATGATCCAGCGATCAGCAACGAGGTCGCGACTGCGGCTCTCCGCTTCTTGACTTCTTTGATGCAA
GGAAAAATAAG
TTTGACAGACGACAAACGCCAGATCAACAAAACGGTTTCCTTGTCGGAATACTTCTTCAAACCGATTATAATCGAGTCTGACGAAGTGTTCGACGGTTTGTTACGCGGG
ATGGCCACTCAGACCAGCCAGAAAATGGATGTCAGCATAATCGAAGACGTAACGAGCAAGTTATTCGCCGCGGGTCAAGATAGCTTAGGCTTGGACGCGATCAGCTTGGACATTCAACGT
GGTCGTGATCATGGCCTGCCAGGTTACAATCATTACAGAAAGTATTGCGGTCTTCCAATTGCGAACACCTTCGATGATTTCTTGGATTACATTTCAGTGGAG
ATGATGAAGAAATTGCGC
GCACTTTACGCTCATCCCGATGACGTAGACCTTATTATCGGGGGTATGGCCGAGAGGCCAGTGGATGATGGCCTATTAGGACCCACCTTCCGCTGTTTAATATTTGAACAGTTTTCGAGA
ACCCGTCGCACCGACAGATATTTCTACGATTCTGCGTATCAACCGCATCCCTTCACACCCG
AGCAATTGGCACAAATACGCAATGTAACGTTGGCAAGAATATTTTGCGACAATGGTAAC
AATATTACCCAAATGCAACCGAACGTATTTCTCCGGCCACAAGCAGAGTAA

Retrieve as FASTA