1. Browse the Database
  2. View Redoxidase
Entry information : MtPrx44 (Medtr2g084000.1[4.0] / Medtr2g084000.1[3.5] / Medtr2g098080.1[3.0])
Entry ID 368
Creation 2005-06-16 (Christophe Dunand)
Last sequence changes 2010-09-15 (Haythem Mhadhbi)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx44 (Medtr2g084000.1[4.0] / Medtr2g084000.1[3.5] / Medtr2g098080.1[3.0])
Name (synonym) MtPrx44 (Medtr2g084000.1[4.0] / Medtr2g084000.1[3.5] / Medtr2g098080.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx035]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Root tips
Roots
Inducer Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx44
start..stop		 S start..stop
MtPrx28 545 0 1..319 1..318
PsPrx11 543 0 1..319 1..318
MtPrx43 534 0 1..319 1..318
MtPrx97 511 0 1..319 1..317
Gene structure Fichier Exons►


exon

Literature and cross-references MtPrx44 (Medtr2g084000.1[4.0] / Medtr2g084000.1[3.5] / Medtr2g098080.1[3.0])
Literature Manthey,K. et al., unpublished
DNA ref. Phytozome 12:   chr2 (35277120..35275180)
Cluster/Prediction ref. Phytozome Gene 12:   31065655 UniGene:   Mtr.9089
Omic ref. Gene atlas:   Mtr.43159.1.S1_at Legoo:   Mtr.43159.1.S1_at
Protein sequence: MtPrx44 (Medtr2g084000.1[4.0] / Medtr2g084000.1[3.5] / Medtr2g098080.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (295)
PWM (Da):   %s   34427.56 (31842.2)  
PI (pH):   %s   9.36 (9.35) Peptide Signal:   %s   cut: 25 range:25-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLIKFFVTLSIFSLLACSTINAQLSPNFYAKTCSNLQTIVRNE
MIKVIQKEARMGASILRLFFHDCFVNGCDASILLDDKGTFVGEKNSGPNQGSARGFEVIDTIKTSVETACKATVSCADILALATRDGIALLGGPSWAVPLGRRDARTASQSAANSQIPGPSSDLSTLTRMFQNKSLTLNDLTVLSG
AHTIGQTECQFFRNRIHNEANIDRNLATLRKRNCPTSGGDTNLAPFDSVTPTKFDNNYYKDLIANKGLLHSDQVLFNGGGSQISLVRKYSRDGAAFSRDFAAAMVKMSKISPLTGTNGEI
RKNCRIVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 2, introns 1 and 2) and 18 ESTs. ESTs are incorrectly compiled in the UniGene Mtr.9089. Cultivar="Jemalong".
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST