Entry information : MtPrx48 (Medtr6g043240.1[4.0] / Medtr1g107070.1+Medtr1g106870.1[3.5])
Entry ID 372
Creation 2006-02-21 (Christophe Dunand)
Last sequence changes 2006-02-21 (Christophe Dunand)
Sequence status complete
Reviewer Catherine Mathe
Last annotation changes 2016-05-20 (Catherine Mathe)
Peroxidase information: MtPrx48 (Medtr6g043240.1[4.0] / Medtr1g107070.1+Medtr1g106870.1[3.5])
Name (synonym) MtPrx48 (Medtr6g043240.1[4.0] / Medtr1g107070.1+Medtr1g106870.1[3.5])
Class Class III peroxidase    [Orthogroup: Prx004]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Cell culture
Roots
Inducers Aphanomyces euteiches infection
Drought
Elicitor treatment (glucan, oligosaccharides, yeast extract, Phytophthora crude extract)
Glomus intraradices infection
Glomus mosseae infection
Glomus versiforme infection
Nitrogen starvation
Nod factor treatment
Nodulation
Pathogen interaction
Phosphate starvation
Phytophthora infection
Rhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx48
start..stop
S start..stop
GmPrx329 545 0 1..352 1..345
LjPrx11 516 0 1..352 1..351
GmPrx276 460 8e-164 10..349 7..345
GmPrx32 454 3e-161 1..352 2..352
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 14950083..14950343 261 N° 2 14949248..14949433 186 N° 3 14945988..14946599 612  
complement(join(14945988..14946599,14949248..14949433,14950083..14950343))


exon

Literature and cross-references MtPrx48 (Medtr6g043240.1[4.0] / Medtr1g107070.1+Medtr1g106870.1[3.5])
Literature REFERENCE 1. Manthey,K. et al., unpublished
REFERENCE 2. Natalija Hohnjec, Martin F. Vieweg, Alfred Puhler, Anke Becker, and Helge Kuster. Overlaps in the Transcriptional Profiles of Medicago truncatula Roots Inoculated with Two Different Glomus Fungi Provide Insights into the Genetic Program Activated during Arbuscular Mycorrhiza. Plant Physiol. 137: 1283-1301(2005).
DNA ref. GenBank:   AC233054.1 (439772..311287) Phytozome 12:   chr6 (14950343..14945988)
Cluster/Prediction ref. Phytozome Gene 12:   31104103 UniGene:   Mtr.7439
Omic ref. Gene atlas:   Mtr.12311.1.S1_at Legoo:   Mtr.12311.1.S1_at
Protein sequence: MtPrx48 (Medtr6g043240.1[4.0] / Medtr1g107070.1+Medtr1g106870.1[3.5])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   352 (321)
PWM (Da):   %s   38068.35 (34684.6) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.39 (7.99) Peptide Signal:   %s   cut: 32 range:32-352
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAKNSASITSFYSFLLISSILFASYFHASKAQTNAPPAVKGLSYGFFAQTCPNLENIVRKHLTKVFKSDNGQAPGLLRIFFHDCFVQGCDGSVLLDGKPGERDQPQNGGMRTEALKTIDDIRALVHKECGRIVSCADITVLAGREAVFLSGGPNFPVPLGRKDGTSFSIKGTSNLPQPFNKTDVTLKVFAAQNFDVTDVVALSGAHTFGRAHCGTFFNRLSPADPTLDKTLAQNLKNTCPNANSGNTANLDIRTPATFDNKYYLDLMNKQGLFTSDQDLNIDSRTKGLVNDFAVNQGLFFEKFVNAFIKVSQLNVLVGNQGEIRGKCNVVNGGKKSVLSTLVEEGMDLIEQF*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 6, 2 introns). 91 ESTs
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGAATAGTGCTTCCATCACTTCTTTCTACTCTTTTCTTTTGATATCTTCCATTCTATTTGCTTCATACTTTCATGCCTCAAAGGCACAAACCAATGCCCCACCAGCAGTAAAA
GGGTTGTCCTATGGTTTCTTTGCCCAAACATGTCCTAACCTTGAAAACATTGTGAGAAAACATCTCACTAAGGTGTTCAAATCAGACAATGGCCAAGCTCCTGGCTTACTTCGTATCTTC
TTTCATGATTGCTTTGTTCAG
GTAATTATATTAAAGTGCAATTTAAAGTGAAGAATAACAAAGACTGAATTGAAATTGAGTTTAGTAGAAGAGACTAAACTTATATAACATGACGAAACA
ATTGTCCGAATCTCGAAATATATACGGGCCAAGGTTTAATCCATGGTGGGGTCCATTGGGAAAAAATATCAACATAAAATAAGGATTTAGTTGATATGTTTTGACTCTTGAAATATATAC
TAACCTATTTTGGTTTAGTTGTGTTGGCTTAAAATTTTGGAGTTTGCTTTTTTCAAGTTTTTAGTTTTGATTTTCCATATGAATTTTGTTAGGTTAGTTTAACTTTTTCAAAAAATATTG
TATCTATGCGAAAATTCATACAATAATGATTTGTAATTGATTGAATATTTTTATTCACCGAGCCTAAAATTTAATATTATTAATTACTCTTATATTATTACAGCGAGTGGATCCTCTCTC
GTGGAGATCCCTCCTATCTTCTGGAGTGCCCCACTATATCCACCTTTAATTACACTCTCCTTTTTTTGATATTACAAACACATTATCTCACTTATTACAAACTTGTATATGATCTAGTTA
ATTTTCCTAACAACTTTTTATATTCTAAAGTTTTCTTGCATGACTTAGTAGTTGATATATATGTATGTAGGGATGTGATGGATCAGTGCTACTGGATGGAAAGCCAGGAGAAAGAGATCA
ACCACAAAATGGAGGCATGAGAACAGAAGCTTTGAAAACTATTGATGATATTAGGGCTCTTGTCCATAAAGAGTGTGGAAGGATTGTTTCTTGTGCAGATATCACTGTCTTGGCTGGCCG
TGAAGCTGTTTTCCTA
GTAAACTCTATACTCCATTTTACTTTTATTTTATATAACTTTTTTTTGGTACATAATTATTTTTCTTACTAATCATGTTTTTGATGTTTTGTACATATATTACT
ATTATAAAAAATTGAATTAACAGTCCCCTTGAGCATAACTCAGTTGGCAGAAACATACATTATTATATGCAGAGGTCGGGGTTCGAACTCCGGACACCCCCATTTATTCACCTTGAAAAA
GGTGAATTATAGCCACTAGGCTATTTGACCAAAAAAAATTAAAATAACAAAAAAAATTAAATTGGTCATCAAATTTTTTAAACAAATTTTATCTTTTTTCATAATATATATATATATATA
ATAAAAAGTCATGTGAAGTGTCCCCTGAGCATAGCTCAGTTGACAGGGACATACATTATTATATGCAGAGGCCCGAGTTTGACCCTCGGACATCCCACTTATTAACATTAAAAAGGGTGA
ATTTTAGCCACTAAAATACTTGAAAAAAAAAAAAAAAAAAAAAAAAAGGTCATGTGAAGTTATGGTGAGAGTATAGTTTATATTATTTTCAAAGAAAATAGGAGACAGTGGTATCATTTC
ATAGACCTTTGTTGTAACATTAAATAGCTATTAACTATAAGTTTATTATAAAAGTTATTAATATTGTGAATCCAAAAAAAAAAAATATTATTCATTTTAGTAGTATCTAAACTTCACTTG
TCATGAAAATAAAATATCACTACTAGTCACAACACACACACATATAAATATATAAAATAGTTTCTTATACATATATAGTACCGTTGATGCAGACTTAATCAAGATTGTGACCGAGTGAGT
TTTACTTGTAAGATTATAGATTTAAATATTAATGCCCACTAGTTAATTCGACAACTGATCAGTAGGTAAAAATTACAGGAATAGAAAGAAAAAAATACGCAGCTAATTAAAAATTTATTT
TGATTGACACATATTAATTAAGCAATGATATTGGTACAACCATTTGATAATAATTTATTGAACAATTTCTTCTTATCTCTTATTATTTTGTCAAAAATACTAAAGAGAAGAAGTAAAAAC
AAAATAAGAGTAAGAGAAACGGTTTTTCAAAAGTTATACCAGAGAATATGATTAGTTTATTAAGATCGCTGGTACTAAAAAACTTGAGTCTTTTTTTAATTACAAAATATTGACAAAGAT
TTTTCTGACAAACATTTTCTCACAATGTTAAATAATCGAGTTATAAACATTTGATATATACAAAATGCGAACATAGAGTTGAGTCTACTATAAAATATTAGACTTTCATGATATGACAAA
CAATTATTCTGATATCAATAGACAATGATGCATGTGTTTAATCGATGTTCAACAATATGCTCAATCTAATTATCTCGAATGTATGCTAACTTAGAAAATCAAACAAAATGTAATTTTTTT
TAGAGGAAAATATTTAGCTAAAAACATTATAAAATATTTTACGCGGGGCCAGTCATTCAAAAAATTTATGATTATATATATATAGATAGATAAGTATATTCTTTCACAGCACATAAAAAT
TAGGCCACTTGATCAAAGACTTAGGTTTTTTCTCCCAACCAAAGTCTTGCTAGAAACCTAGAATATTAATTATCTTCAAAAAAAAAATTATCTCAAAGGCACAAACCCACGTTGCAAGAC
TCAAAAGTAAACTTTAATTATTATTTTTCAGACAATTGTTCTAACAACTTTTGACCTTTTCTTTTGTTTGACAACTCTTTTGTCATTTTCTAATCCTCAAACTTTAAAGTATTGTTAACT
TTTTACATTATTCTATTCTTAGTTTTAATTTTCTAAATATGCTTTACCTAAAGGTTATATTTTATATTGACTATGCTAATACAGCTTTTTAGTAATATAATTATATTAGAAGACAGCTTT
AAGAAAAGAGATAAGGATTGAGTTATTTTTGTTGATACATGTGAAAAATGATGCTAATCCTAGATAAAACCTAATATATAGAATCAAAAGCATCTTCTATCCCAAAAATAAATTAATGAA
AAGCATATTTCAAAAGCCTGCTTGTATTTGATTTTTCTACTTGCATTGGACTTTGGATGTCTAAAATCGATTATACCACCAAAAGTTGCAAGATTGAACTTTGGAAATAATTGTCTACAA
AAGAGTAGTTCAATGATTTCATTTGATTCTCTGCTACCAACAATAATTCTTCTCCTGTAAAAATTACGAGTCTGGTTAAGGAGTGTTCTAAGAAGCGTCCACTGATCAATGAATTGAGTA
GTAAACTATTTATTAAAAAATCAAACACTTCAATTTTTAATGCATTAAATACACAAGTTTCAAAGTTACAAGATCATCAACTTATTATTTCTGACACTCGAAGAATGTCCTTAGGACACT
TGTATGCATTTACCTAAACCTATTTATCAATATTTGTTTTTAATTTTTTTTTTAAATAATGGCATTTGGATGAACAAATTTGATACTATTCCAACACTATTTGGCATCATGGTAAAAAAA
AAAAAAAACAAATATATAATATTATTCTTTTTCTTAAAAAAACTCGGTATCCGATCCAAGTACCGACTAATCTGATATTTAATATTATTCTTAATTGCAAATTTTTCATTTTCTAACCAT
GATTTCTCTCTTTTACCTTACCAGTCAGGAGGACCCAATTTTCCAGTACCACTAGGAAGAAAAGATGGAACATCTTTTAGCATAAAAGGAACAAGTAACCTACCCCAACCATTCAACAAA
ACAGATGTTACACTCAAAGTTTTTGCAGCCCAAAACTTTGATGTCACAGATGTTGTTGCATTATCAGGTGCACACACATTTGGTCGTGCACATTGTGGAACATTCTTCAATAGACTCTCT
CCAGCGGACCCTACATTGGACAAAACCCTAGCTCAAAACCTTAAAAACACTTGCCCTAATGCAAATTCAGGTAACACTGCAAACCTAGACATAAGGACCCCGGCAACATTCGACAACAAA
TACTACCTTGATTTGATGAACAAACAAGGTTTGTTCACTTCCGACCAAGATTTGAACATTGATTCGAGGACGAAGGGTTTGGTTAATGATTTCGCTGTTAATCAGGGTTTGTTCTTTGAG
AAGTTTGTTAATGCTTTTATTAAGGTGAGTCAGTTGAATGTTTTGGTTGGAAATCAAGGTGAAATTCGTGGTAAATGTAATGTGGTAAATGGTGGTAAGAAATCTGTTTTGTCTACTTTG
GTGGAAGAGGGAATGGACTTGATTGAGCAATTTTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTAAGAATAGTGCTTCCATCACTTCTTTCTACTCTTTTCTTTTGATATCTTCCATTCTATTTGCTTCATACTTTCATGCCTCAAAGGCACAAACCAATGCCCCACCAGCAGTAAAA
GGGTTGTCCTATGGTTTCTTTGCCCAAACATGTCCTAACCTTGAAAACATTGTGAGAAAACATCTCACTAAGGTGTTCAAATCAGACAATGGCCAAGCTCCTGGCTTACTTCGTATCTTC
TTTCATGATTGCTTTGTTCAG
GGATGTGATGGATCAGTGCTACTGGATGGAAAGCCAGGAGAAAGAGATCAACCACAAAATGGAGGCATGAGAACAGAAGCTTTGAAAACTATTGATGAT
ATTAGGGCTCTTGTCCATAAAGAGTGTGGAAGGATTGTTTCTTGTGCAGATATCACTGTCTTGGCTGGCCGTGAAGCTGTTTTCCTA
TCAGGAGGACCCAATTTTCCAGTACCACTAGGA
AGAAAAGATGGAACATCTTTTAGCATAAAAGGAACAAGTAACCTACCCCAACCATTCAACAAAACAGATGTTACACTCAAAGTTTTTGCAGCCCAAAACTTTGATGTCACAGATGTTGTT
GCATTATCAGGTGCACACACATTTGGTCGTGCACATTGTGGAACATTCTTCAATAGACTCTCTCCAGCGGACCCTACATTGGACAAAACCCTAGCTCAAAACCTTAAAAACACTTGCCCT
AATGCAAATTCAGGTAACACTGCAAACCTAGACATAAGGACCCCGGCAACATTCGACAACAAATACTACCTTGATTTGATGAACAAACAAGGTTTGTTCACTTCCGACCAAGATTTGAAC
ATTGATTCGAGGACGAAGGGTTTGGTTAATGATTTCGCTGTTAATCAGGGTTTGTTCTTTGAGAAGTTTGTTAATGCTTTTATTAAGGTGAGTCAGTTGAATGTTTTGGTTGGAAATCAA
GGTGAAATTCGTGGTAAATGTAATGTGGTAAATGGTGGTAAGAAATCTGTTTTGTCTACTTTGGTGGAAGAGGGAATGGACTTGATTGAGCAATTTTAA

Retrieve as FASTA