Entry information : MtPrx49 (Medtr4g029180.1[4.0])
Entry ID 373
Creation 2008-12-07 (Christophe Dunand)
Last sequence changes 2014-07-30 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-07-30 (Christophe Dunand)
Peroxidase information: MtPrx49 (Medtr4g029180.1[4.0])
Name (synonym) MtPrx49 (Medtr4g029180.1[4.0])
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue type Roots nodules
Inducers Nodulation
Sinorhizobium inoculation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx49
start..stop
S start..stop
MtPrx81 596 0 1..321 1..321
GmPrx96 488 1.12e-175 1..321 1..319
GmPrx97 474 2.13e-170 1..321 1..319
GmPrx129 474 4.16e-170 1..321 1..319
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '373' 'complement(join(10066073..10066627,10067323..10067517,10067892..10068107))' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10067892..10068107 214 N° 2 10067323..10067517 193 N° 3 10066073..10066627 553  
complement(join(10066073..10066627,10067323..10067517,10067892..10068107))


exon

Literature and cross-references MtPrx49 (Medtr4g029180.1[4.0])
Literature Journet,E.P. et al., unpublished
DNA ref. Phytozome 12:   chr4 (10068107..10066073)
EST ref. GenBank:   GE351905 [3' end]
Cluster/Prediction ref. Phytozome Gene 12:   31110628 UniGene:   Mtr.10197 [5' end]
Omic ref. Gene atlas:   Mtr.10958.1.S1_at Legoo:   Mtr.10958.1.S1_at
Protein sequence: MtPrx49 (Medtr4g029180.1[4.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   321 (296)
PWM (Da):   %s   35304.98 (32390.5)  
PI (pH):   %s   9.72 (9.55) Peptide Signal:   %s   cut: 26 range:26-321
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSSHRFFSKFFYTLVLATLTTTTFSALTTNYYDYTCPNALSTIKS
VVKAAVQRENRMGASLLRLHFHDCFVN
GCDGSILLDSTPSMDSEKNANPNINSARGFEVVDEIKDAVDKACGKPVVSCADILAIAARDSVVALGGPSWKVKLGRRDSKTASRADADSGNIPGPAFSLSQLIKNFDNQGLNEKDLVAL
SGAHTIGFSRCFLFRDRIYKDNNINAYFAKQLQNVCPREGGDSNLAPLDSVTSAKFDVAYYSQLIKKKGLLHSDQELLKGGYTGALVRKYRRDTRTFYKDFAKSMIKMGNIKPLTGKQGE
VRYNCRRAN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, introns 1 and 2) and 9 ESTs. Cultivar="A17".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCACATAGGTTTTTCTCAAAGTTCTTCTACACATTAGTGTTAGCAACTCTTACAACAACAACATTTTCAGCACTCACAACAAATTACTATGATTACACATGCCCTAATGCTTTG
AGCACTATTAAAAGTGTTGTTAAAGCTGCAGTTCAAAGAGAGAACCGTATGGGTGCTTCTTTACTACGCTTGCACTTTCATGATTGCTTTGTTAAT
GTAAGAATATTATCATCATTTCTC
TGTGTGTATACATAATATTATTACTTCAAAAAAAAATTATATCAAAATTTTCAATTTGTCTCTAAATCATACTTCTAGAAATATTAAAATGACAAAAATTATTTACATAAATAATAAACT
AACTCTCTATTTCTTTCATCACAAAATTTATAATGTTCTCTAATTTTTTTTTTAGTAATGATCTATCATAAATAGTGACAAATTAATTTTAGTTACTTTTCTAAATGAATCAATAAATTT
ATTTTAATGATTAATTTATAAACTGATTAGACTGATAATATGAAAATTAGTCGAGAAATTAAACTAATTAAACTAATTTATTTTAATGATTAATTTATGGTGTGATTCAGGGGGTTGTGA
TGGTTCAATTCTTCTAGACTCTACACCTTCAATGGACAGTGAAAAAAATGCAAATCCAAATATAAATTCAGCAAGAGGATTTGAAGTTGTTGATGAGATTAAGGATGCTGTTGATAAAGC
ATGTGGAAAACCAGTTGTTTCTTGTGCAGACATTTTGGCCATAGCTGCAAGAGACTCTGTCGTTGCG
GTTAGTAATAATATTCTACATTTTAACTCCTTCAAAACAAAAATATTCTACAT
TTTAATATATATATATATATATATTTTATTTTATTTTGAATTAGTCCGTAATTTTCAAACAGAATTAGTCAGCATGGTTGGTTAATTTTTTTGATCAAATGAATAAAATAAAGTTAATAA
AAGGAAGTTACTAAGAGTTAAGCATTTATATATGAAATTTTCTAATTTATACCACCAACATTGAATATATCAAAATTAAAATGCCCAAAGTTGTGTAACTTGCTAATAAATTTATTCTAA
CGATATGACTGAGTCGATTTTACTTATATTAGTATTTACTATTTGAATGTATCAAAGTAAAGCCACACAAGTTACATGCTACAAATATTTTTTTGGTAAACTAATTATTTTTGTTGATAG
AGTAAACTAAAATATTTTAGACGTATAAAAAATAATATCACGAGATAATTGAGATATTTTTTTTTTTTCATCGATATTTTCTTATATTGAATATAACTTGAGACTCAAGTATCTATAACT
CATGTCATTCCATGCATGATTCCTTCATTAATTCCATATGTGTGTATTAGAGATTTTTCAAATCCTACAAAAGCTTCTTCAATATACAAAAAAGGACAAATAAAAATGTTGCTTGCATAA
CACGAAATTTAAATTGAAATTTACCATTATATATGGATGCAGTTTTAGGAGGACCATCATGGAAAGTGAAACTAGGAAGAAGAGACTCAAAGACAGCAAGTCGTGCCGATGCAGATTCAG
GCAATATCCCCGGACCAGCATTCAGTCTTTCTCAACTCATCAAAAACTTCGACAATCAAGGCCTAAACGAAAAAGACCTCGTTGCCCTATCTGGAGCACACACTATTGGATTCTCGCGTT
GTTTTTTATTTAGAGACCGAATCTACAAAGACAACAACATCAATGCATATTTCGCAAAACAACTTCAAAACGTTTGCCCTAGAGAAGGCGGAGACTCCAACCTCGCTCCTCTCGACAGTG
TAACATCAGCGAAATTTGATGTGGCTTATTACTCGCAATTGATTAAAAAGAAAGGGCTTCTTCATTCTGATCAAGAATTGTTGAAGGGTGGTTATACTGGAGCTTTGGTTAGAAAATATA
GGCGTGATACAAGAACTTTCTATAAGGACTTTGCAAAATCTATGATTAAGATGGGAAATATTAAGCCACTTACTGGGAAACAGGGTGAAGTTCGTTACAATTGTAGGAGAGCCAATTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTCACATAGGTTTTTCTCAAAGTTCTTCTACACATTAGTGTTAGCAACTCTTACAACAACAACATTTTCAGCACTCACAACAAATTACTATGATTACACATGCCCTAATGCTTTG
AGCACTATTAAAAGTGTTGTTAAAGCTGCAGTTCAAAGAGAGAACCGTATGGGTGCTTCTTTACTACGCTTGCACTTTCATGATTGCTTTGTTAAT
GGTTGTGATGGTTCAATTCTTCTA
GACTCTACACCTTCAATGGACAGTGAAAAAAATGCAAATCCAAATATAAATTCAGCAAGAGGATTTGAAGTTGTTGATGAGATTAAGGATGCTGTTGATAAAGCATGTGGAAAACCAGTT
GTTTCTTGTGCAGACATTTTGGCCATAGCTGCAAGAGACTCTGTCGTTGCG
TTAGGAGGACCATCATGGAAAGTGAAACTAGGAAGAAGAGACTCAAAGACAGCAAGTCGTGCCGATGCA
GATTCAGGCAATATCCCCGGACCAGCATTCAGTCTTTCTCAACTCATCAAAAACTTCGACAATCAAGGCCTAAACGAAAAAGACCTCGTTGCCCTATCTGGAGCACACACTATTGGATTC
TCGCGTTGTTTTTTATTTAGAGACCGAATCTACAAAGACAACAACATCAATGCATATTTCGCAAAACAACTTCAAAACGTTTGCCCTAGAGAAGGCGGAGACTCCAACCTCGCTCCTCTC
GACAGTGTAACATCAGCGAAATTTGATGTGGCTTATTACTCGCAATTGATTAAAAAGAAAGGGCTTCTTCATTCTGATCAAGAATTGTTGAAGGGTGGTTATACTGGAGCTTTGGTTAGA
AAATATAGGCGTGATACAAGAACTTTCTATAAGGACTTTGCAAAATCTATGATTAAGATGGGAAATATTAAGCCACTTACTGGGAAACAGGGTGAAGTTCGTTACAATTGTAGGAGAGCC
AATTAA

Retrieve as FASTA