Entry information : SsqPrx01_Ox8 (SSP3)
Entry ID 3772
Creation 2006-08-25 (Christophe Dunand)
Last sequence changes 2015-12-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2015-12-07 (Achraf Jemmat)
Peroxidase information: SsqPrx01_Ox8 (SSP3)
Name (synonym) SsqPrx01_Ox8 (SSP3)
Class Class III peroxidase    [Orthogroup: Prx003]
Taxonomy Eukaryota Viridiplantae Streptophyta Asteraceae Senecio
Organism Senecio squalidus    [TaxId: 121554 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value SsqPrx01_Ox8
start..stop
S start..stop
SsqPrx01_OS-Bill4 669 0 1..326 1..326
SsqPrx01_Ox15 667 0 1..326 1..326
SsqPrx01_A34-4-23 664 0 1..326 1..326
SsqPrx02_Ox10 659 0 1..326 1..326
Gene structure Fichier Exons


exon

Literature and cross-references SsqPrx01_Ox8 (SSP3)
Literature McInnis S.M., Costa L.M., Guttierez-Marcos J.F., Henderson C.A., Hiscock S.J. Isolation and characterization of a polymorphic stigma specific class III peroxidase gene from Senecio squalidus L. (Asteraceae). Plant Mol. Biol. 57:659-677(2005).
Protein ref. UniProtKB:   Q4A3Z1
DNA ref. GenBank:   AJ810534.1 (23..1181)
Protein sequence: SsqPrx01_Ox8 (SSP3)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (299)
PWM (Da):   %s   35658.3 (32716.7) Transmb domain:   %s   o10-32i
PI (pH):   %s   7.74 (7.73) Peptide Signal:   %s   cut: 28 range:28-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEVYSHLRTPIILFVVVFAALTSLALGCKVGFYQATCPRAETIVQ
SVVKSAIRSNPTYAPGILRLFFHDCFVNGCDASVLLDGSTSEQTASTNSHLRGFEVISAAKARVETECPGVVSCA
DILALAARDSVVE
TGLPRWEVPTGRRDGLVSRAEDALKLPGSRDSAEVQIEKFAAKGLNIEELVTLVGGHTIGTSACARFVHRLYNYSNTNAPDPHIDQAFLPNLQTLCPEHGDRTIRVD
LDTGSVNNFDTSYYENLRKGRGVLESDTKLWTHHITQNLVQQFISVGRPNQLTFSKKFARAMVKLSQVEVKTGNEGEIRRVCNRIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 2 and 3). Isolate="Ox 8".
DNA
Send to BLAST