Entry information : PcMnP01-1B_RP78 (PcMnP01b_RP78)
Entry ID 3829
Creation 2006-08-29 (Filippo Passardi)
Last sequence changes 2011-11-23 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-03-28 (Catherine Mathe (Scipio))
Peroxidase information: PcMnP01-1B_RP78 (PcMnP01b_RP78)
Name (synonym) PcMnP01-1B_RP78 (PcMnP01b_RP78)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Corticiaceae Phanerochaete
Organism Phanerochaete chrysosporium    [TaxId: 5306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PcMnP01-1B_RP78
start..stop
S start..stop
PcMnP01_OGC101 764 0 1..378 1..378
PcMnP01-1A_RP78 764 0 1..378 1..378
PsoMnP02 662 0 1..378 1..377
PcMnP05 655 0 1..378 1..381
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 855169..855288 120 N° 2 855057..855108 52 N° 3 854933..854999 67 N° 4 854693..854870 178
N° 5 854399..854620 222 N° 6 853915..854329 415 N° 7 853774..853856 83  
complement(join(853774..853856,853915..854329,854399..854620,854693..854870,8549 33..854999,855057..855108,855169..855288))


exon

Literature and cross-references PcMnP01-1B_RP78 (PcMnP01b_RP78)
Literature Martinez,D., Larrondo,L.F., Putnam,N., Sollewijn Gelpke,M.D., Huang,K., Chapman,J., Helfenbein,K.G., Ramaiya,P., Detter,J.C., Larimer,F., Coutinho,P.M., Henrissat,B., Berka,R., Cullen,D. and Rokhsar,D. Genome sequence of the lignocellulose degrading fungus Phanerochaete chrysosporium strain RP78. Nat. Biotechnol. 22 (6), 695-700 (2004).
DNA ref. JGI genome:   scaffold_15 (855288..853774)
Protein sequence: PcMnP01-1B_RP78 (PcMnP01b_RP78)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   378 (360)
PWM (Da):   %s   39432.47 (37601.4)  
PI (pH):   %s   4.56 (4.43) Peptide Signal:   %s   cut: 19 range:19-378
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFKSLIAFVALAAAVRAAPTAVCPDGTRVSHAACCAFIPLAQDLQETIFQNECGEDAHEVIRLTFHDAIAISRSQGPKAGGGADGSMLLFPTVEPNFSANNGIDDSVNNLIPFMQKHNTISAADLVQFAGAVALSNCGAPRLEFLAGRPNKTIAAVDGLIPEPQDSVTKILQRFEDAGGFTPFEVVSLLASHSVARADKVDQTIDAAPFDSTPFTFDTQVFLEVLLKGVGFPGSANNTGEVASPLPLGSGSDTGEMRLQSDFALAHDPRTACIWQGFVNEQAFMAASFKAAMSKLAVLGHNRNSLIDCSDVVPVPKPATGQPAMFPASTGPQDLELSCPSERFPTLTTQPGASQSLIAHCPDGSMSCPGVQFNGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns). No EST. Strain="RP-78".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGTCCCTCATCGCCTTCGTCGCCCTCGCGGCCGCTGTCCGTGCTGCCCCGACCGCGGTCTGCCCCGACGGCACCCGCGTCAGCCACGCGGCGTGCTGCGCTTTCATCCCT
GTAAGCAGGCAGAGTTCGCACTAATCGACACTTTCAAAGCCTGACACTGGCATGTCTCAGCTCGCGCAGGATCTGCAAGAGACCATCTTCCAGAACGAGTGCGGTGAAGACGGTCAGTGG
TTGTCCAGCAGCTCCAACAGGCGTTGCCGAGTCTCATCGTATTTCGCAGCCCACGAGGTCATCCGTCTGACGTTCCACGACGCCATCGCCATCTCTCGCTCCCAGGGCCCCAAGGCGTGA
GTCTCGTGACGGCCGAGCTCGTTCATCGCTCTGTGTCCTGACAGCAGCTGTGTTTCAGCGGCGGTGGTGCCGACGGCTCGATGCTCCTGTTCCCGACGGTCGAGCCCAACTTCTCTGCCA
ACAACGGCATCGACGACTCGGTCAACAACCTGATCCCGTTCATGCAGAAGCACAACACGATCAGCGCCGCCGACCTCGTCCAGTTCGCGGGTGCCGTCGCGCTGAGCAACTGCCCC
GTAA
GCAGTCTTTCAATGCCTCGGTTTGTGCGCGACAGTCGGTTCTGACCAGTGACCACGCCTGTGGGGCAGGGTGCACCCCGGCTCGAGTTCCTGGCGGGCCGCCCGAACAAGACGATCGCTG
CCGTCGACGGACTGATCCCCGAGCCGCAGGACAGCGTGACCAAGATCCTGCAGCGTTTCGAGGACGCCGGTGGCTTCACGCCCTTCGAGGTCGTCTCTCTGCTGGCCTCGCACTCTGTCG
CGCGCGCGGACAAGGTCGACCAGACGATCGACGCTGCGCCCTTTGACTCG
GTCAGTGACTGCCCGTGTTGTTGAGTTACGCCAGACACGGCTAACGGGCAAGTCCCTCCCTCTCCCCAGA
CTCCGTTCACGTTCGACACGCAGGTGTTCCTCGAGGTGCTGCTCAAGGGCGTCGGCTTCCCGGGCTCCGCGAACAACACGGGCGAGGTGGCGTCGCCTCTCCCGCTCGGCAGCGGCAGCG
ACACGGGCGAGATGCGGCTGCAGTCCGACTTTGCGCTCGCGCACGACCCGCGCACGGCGTGCATCTGGCAGGGCTTCGTCAACGAGCAGGCGTTCATGGCCGCGAGCTTCAAGGCGGCGA
TGAGCAAGCTCGCGGTGCTCGGGCACAATCGCAACAGCCTGATCGACTGCAGCGACGTCGTGCCGGTGCCGAAGCCCGCGACTGGCCAGCCCGCGATGTTCCCGGCGTCGACTGGCCCGC
AGGACCTGGAGCTGTCGTGCCCGTCGGAACGTTTCCCGACGCTGACCACCCAGC
GTACGTACTTGTGTACTTCTTCAATTACAGGATCGCTAATTAGTTCGGCGCACTGCAGCGGGCGCG
TCGCAGTCGCTGATTGCGCACTGCCCCGACGGCAGCATGTCCTGCCCCGGTGTCCAGTTCAACGGTCCCGCATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTCAAGTCCCTCATCGCCTTCGTCGCCCTCGCGGCCGCTGTCCGTGCTGCCCCGACCGCGGTCTGCCCCGACGGCACCCGCGTCAGCCACGCGGCGTGCTGCGCTTTCATCCCT
CTCGCGCAGGATCTGCAAGAGACCATCTTCCAGAACGAGTGCGGTGAAGACGCCCACGAGGTCATCCGTCTGACGTTCCACGACGCCATCGCCATCTCTCGCTCCCAGGGCCCCAAGGCC
GGCGGTGGTGCCGACGGCTCGATGCTCCTGTTCCCGACGGTCGAGCCCAACTTCTCTGCCAACAACGGCATCGACGACTCGGTCAACAACCTGATCCCGTTCATGCAGAAGCACAACACG
ATCAGCGCCGCCGACCTCGTCCAGTTCGCGGGTGCCGTCGCGCTGAGCAACTGCCCC
GGTGCACCCCGGCTCGAGTTCCTGGCGGGCCGCCCGAACAAGACGATCGCTGCCGTCGACGGA
CTGATCCCCGAGCCGCAGGACAGCGTGACCAAGATCCTGCAGCGTTTCGAGGACGCCGGTGGCTTCACGCCCTTCGAGGTCGTCTCTCTGCTGGCCTCGCACTCTGTCGCGCGCGCGGAC
AAGGTCGACCAGACGATCGACGCTGCGCCCTTTGACTCG
ACTCCGTTCACGTTCGACACGCAGGTGTTCCTCGAGGTGCTGCTCAAGGGCGTCGGCTTCCCGGGCTCCGCGAACAACACG
GGCGAGGTGGCGTCGCCTCTCCCGCTCGGCAGCGGCAGCGACACGGGCGAGATGCGGCTGCAGTCCGACTTTGCGCTCGCGCACGACCCGCGCACGGCGTGCATCTGGCAGGGCTTCGTC
AACGAGCAGGCGTTCATGGCCGCGAGCTTCAAGGCGGCGATGAGCAAGCTCGCGGTGCTCGGGCACAATCGCAACAGCCTGATCGACTGCAGCGACGTCGTGCCGGTGCCGAAGCCCGCG
ACTGGCCAGCCCGCGATGTTCCCGGCGTCGACTGGCCCGCAGGACCTGGAGCTGTCGTGCCCGTCGGAACGTTTCCCGACGCTGACCACCCAGC
CGGGCGCGTCGCAGTCGCTGATTGCG
CACTGCCCCGACGGCAGCATGTCCTGCCCCGGTGTCCAGTTCAACGGTCCCGCATAA

Retrieve as FASTA