Entry information : CsuMnP11 (MnP11)
Entry ID 3832
Creation 2006-08-29 (Filippo Passardi)
Last sequence changes 2011-11-04 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2012-04-02 (Catherine Mathe (Scipio))
Peroxidase information: CsuMnP11 (MnP11)
Name (synonym) CsuMnP11 (MnP11)
Class Manganese peroxidase    [Orthogroup: MnP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Coriolaceae Ceriporiopsis
Organism Ceriporiopsis subvermispora    [TaxId: 42742 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CsuMnP11
start..stop
S start..stop
CsuMnP05 657 0 1..382 1..377
CsuMnP02 649 0 1..382 1..382
CsuMnP04 646 0 1..382 1..377
CsuMnP10 639 0 1..382 1..378
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 448324..448443 120 N° 2 448498..448549 52 N° 3 448606..448672 67 N° 4 448731..448908 178
N° 5 448966..449187 222 N° 6 449244..449670 427 N° 7 449732..449814 83  
join(448324..448443,448498..448549,448606..448672,448731..448908,448966..449187, 449244..449670,449732..449814)


exon

Literature and cross-references CsuMnP11 (MnP11)
DNA ref. JGI genome:   scaffold_19 (448324..449814)
Protein sequence: CsuMnP11 (MnP11)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382 (364)
PWM (Da):   %s   39755.37 (37953.4)  
PI (pH):   %s   4 (3.96) Peptide Signal:   %s   cut: 19 range:19-382
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFATLLALVTLAATARAAPTAVCSDGTRVSNAVCCDFIPLAQDLQNTIFMNDCGEDAHESIRLTFHDAIAISRSQGAAAGGGADGSMLIFPTVEPNFAANNGIDDSVNNLIPFLSTHPTISAGDLVQFAGAVALSNCGAPQLEFLAGRKNATAPAVDGLIPEPQDSVTSILDRFSDAGGFSPFEVVSLLASHTVARADKVDTTLDAAPFDSTPFTFDTQIFLEVLLKGVGFPGTDNNTGEVASPLPLGNIVSGGNDTGEMRLQSDFALARDERTACFWQGFVNEQEFMAESFKAAMSKLAVLGSNRDELIDCSDVVPTPKPAVNKPASFPATTGPQDLELTCTAERFPTLSVDPGAQETLIPHCSDGGQDCPSVQFTGPA

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (6 introns)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCGCTACACTCCTCGCCCTTGTAACCCTCGCTGCAACTGCTCGCGCTGCGCCGACCGCGGTTTGCTCTGATGGCACCCGCGTCAGCAACGCCGTCTGCTGCGACTTCATTCCA
GTATGAGCAACAAGCCTTCAAGTCGCTTGGTGTCCTGACTAAATTGCCCAACAGCTCGCTCAGGATTTGCAGAACACCATATTCATGAACGATTGCGGTGAAGATGGTTGGTGCCATTTA
TCCTTCATGAATTTCGTTAATGCTGATGTCGCTGTTCCGTAGCACACGAAAGCATCCGTCTGACCTTCCATGACGCTATTGCGATTTCTCGCAGCCAGGGTGCCGCAGCGTATGTCGAGT
ATTTCACGTTGATTATTGATATGACTAAATACACGAATGATCTCTAGCGGTGGCGGAGCTGACGGTTCCATGCTCATTTTCCCCACTGTGGAACCGAATTTCGCCGCGAATAACGGCATT
GACGACTCCGTGAACAACTTGATTCCGTTCCTTTCCACGCACCCGACAATCAGTGCCGGTGACCTTGTCCAGTTCGCCGGCGCGGTAGCGCTCAGTAACTGCCCC
GTAAGTGGTCATAAA
CGTCGTACACAGCAATCCCTTTTGAGACGTGCAATATCGTAGGGTGCTCCTCAGCTCGAGTTCTTGGCGGGCCGCAAGAATGCGACCGCTCCCGCTGTCGATGGTTTGATCCCGGAGCCT
CAAGACAGCGTGACGAGTATTCTCGACCGCTTTTCCGATGCGGGTGGCTTCTCACCATTCGAGGTTGTCTCGCTCCTCGCTTCGCACACCGTCGCACGTGCCGATAAGGTTGACACCACC
CTCGATGCTGCTCCCTTTGACTCG
GTCAGTGGACATTGTCTGCTAAGCATACAACACGTACTGAGATGCTTTCTACATAGACACCTTTCACCTTTGACACCCAGATCTTCCTCGAGGTTC
TACTGAAGGGCGTTGGCTTCCCCGGAACTGACAACAACACCGGTGAAGTTGCATCCCCTCTACCTCTCGGCAACATTGTCAGCGGCGGAAATGACACTGGCGAGATGCGCCTCCAATCCG
ACTTCGCACTCGCGCGTGATGAGCGTACTGCATGTTTCTGGCAGGGATTCGTCAACGAGCAGGAGTTCATGGCAGAGAGTTTCAAGGCCGCCATGTCCAAGCTTGCGGTCCTTGGCTCGA
ATCGCGATGAGCTCATTGACTGTTCCGACGTTGTCCCCACGCCCAAGCCCGCCGTTAACAAGCCGGCGTCGTTCCCCGCAACGACCGGACCTCAGGATCTCGAGCTTACCTGCACCGCGG
AGCGCTTCCCGACGCTCTCCGTCGATC
GTGAGTGGATTACTCTTTGCAATGTGATTGATGCAGAATCTGACGTGACTTTACATTATAGCTGGTGCACAAGAGACTCTCATCCCGCACTGC
TCCGATGGTGGCCAAGACTGCCCGTCTGTCCAATTCACCGGCCCTGCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTTTCGCTACACTCCTCGCCCTTGTAACCCTCGCTGCAACTGCTCGCGCTGCGCCGACCGCGGTTTGCTCTGATGGCACCCGCGTCAGCAACGCCGTCTGCTGCGACTTCATTCCA
CTCGCTCAGGATTTGCAGAACACCATATTCATGAACGATTGCGGTGAAGATGCACACGAAAGCATCCGTCTGACCTTCCATGACGCTATTGCGATTTCTCGCAGCCAGGGTGCCGCAGCC
GGTGGCGGAGCTGACGGTTCCATGCTCATTTTCCCCACTGTGGAACCGAATTTCGCCGCGAATAACGGCATTGACGACTCCGTGAACAACTTGATTCCGTTCCTTTCCACGCACCCGACA
ATCAGTGCCGGTGACCTTGTCCAGTTCGCCGGCGCGGTAGCGCTCAGTAACTGCCCC
GGTGCTCCTCAGCTCGAGTTCTTGGCGGGCCGCAAGAATGCGACCGCTCCCGCTGTCGATGGT
TTGATCCCGGAGCCTCAAGACAGCGTGACGAGTATTCTCGACCGCTTTTCCGATGCGGGTGGCTTCTCACCATTCGAGGTTGTCTCGCTCCTCGCTTCGCACACCGTCGCACGTGCCGAT
AAGGTTGACACCACCCTCGATGCTGCTCCCTTTGACTCG
ACACCTTTCACCTTTGACACCCAGATCTTCCTCGAGGTTCTACTGAAGGGCGTTGGCTTCCCCGGAACTGACAACAACACC
GGTGAAGTTGCATCCCCTCTACCTCTCGGCAACATTGTCAGCGGCGGAAATGACACTGGCGAGATGCGCCTCCAATCCGACTTCGCACTCGCGCGTGATGAGCGTACTGCATGTTTCTGG
CAGGGATTCGTCAACGAGCAGGAGTTCATGGCAGAGAGTTTCAAGGCCGCCATGTCCAAGCTTGCGGTCCTTGGCTCGAATCGCGATGAGCTCATTGACTGTTCCGACGTTGTCCCCACG
CCCAAGCCCGCCGTTAACAAGCCGGCGTCGTTCCCCGCAACGACCGGACCTCAGGATCTCGAGCTTACCTGCACCGCGGAGCGCTTCCCGACGCTCTCCGTCGATC
CTGGTGCACAAGAG
ACTCTCATCCCGCACTGCTCCGATGGTGGCCAAGACTGCCCGTCTGTCCAATTCACCGGCCCTGCATGA

Retrieve as FASTA