Entry information : MtAPx02 (Medtr4g073410.1[4.0] / Medtr4g098670.1[3.0])
Entry ID 3943
Creation 2006-09-22 (Filippo Passardi)
Last sequence changes 2006-09-22 (Filippo Passardi)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2014-07-31 (Christophe Dunand)
Peroxidase information: MtAPx02 (Medtr4g073410.1[4.0] / Medtr4g098670.1[3.0])
Name (synonym) MtAPx02 (Medtr4g073410.1[4.0] / Medtr4g098670.1[3.0])
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation Peroxisomal
Tissue types Flowers
Glandular trichome
Leaves
Pods
Roots
Stems
Inducers Drought
Phosphate starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtAPx02
start..stop
S start..stop
LjAPx02 499 0 1..287 1..287
GmAPx03 493 5.63e-179 1..287 1..287
VuAPx02 493 6.49e-179 1..287 1..287
GmAPx04 488 5.5e-177 1..287 1..287
Gene structure Fichierperl './assets/cgi-bin/draw_exon.pl' '3943' 'join(27800556..27800671,27800791..27800915,27801012..27801061,27802619..27802684,27802766..27802814,27802996..27803078,27803158..27803237,27803421..27803523,27804145..27804336)' Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 27800556..27800671 114 N° 2 27800791..27800915 123 N° 3 27801012..27801061 48 N° 4 27802619..27802684 64
N° 5 27802766..27802814 47 N° 6 27802996..27803078 81 N° 7 27803158..27803237 78 N° 8 27803421..27803523 101
N° 9 27804145..27804336 190  
join(27800556..27800671,27800791..27800915,27801012..27801061,27802619..27802684 ,27802766..27802814,27802996..27803078,27803158..27803237,27803421..27803523,278 04145..27804336)


exon

Literature and cross-references MtAPx02 (Medtr4g073410.1[4.0] / Medtr4g098670.1[3.0])
Literature Shaull,S., Lin,S., Dixon,R., May,G., Sumner,L., Gonzales,B., Cook,D., Kim,D. and Roe,B.A. Direct Submission (19-APR-2006)
Protein ref. UniProtKB_Uniparc:   Q1T679
DNA ref. Phytozome 12:   chr4 (27800556..27804336)
Cluster/Prediction ref. Phytozome Gene 12:   31106305 UniGene:   Mtr.4466
Protein sequence: MtAPx02 (Medtr4g073410.1[4.0] / Medtr4g098670.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   287
PWM (Da):   %s   31586.16 Transmb domain:   %s   o258-280i
PI (pH):   %s   6.52
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAFPVVVDSEYLKEIEKARRDLRALIANRNCAPLMLRLAWHDAGTYDAKTKTGGPNASIRNEEEFSHGANNGLKKAIDFEEVKAKHPKISYADLYLAGVVAVEVTGGPTVNFVPGRRDSK
VCTRDGRLPDAKQ
GVSHLRDIFYRMGLTDKDIVALSGAHTGRAHPERSGFDGPWTEDPLKFDNSYFQILLEEDSAALLKLPTDRALLDDPEFRRYVELYADEDAFFRDYAESHKKLSELG
FAPSSKATAPVDATVLAQSAFGVVAAAAVVILGYLYETHKRGK*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 4, 8 introns) and 45 ESTs.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCCCGGTAGTAGTAGACTCAGAGTATCTCAAGGAAATCGAAAAAGCTCGTCGCGATCTCCGTGCTCTCATCGCCAACAGAAACTGTGCTCCCCTCATGCTTCGCTTAGCGCGT
AAGGGATTTCTCTTCATCTTCACTTTTCCTTGTTTTTTTTTTTTCTCTTCCGATTTCGGTTTCTTAACGATTTTTAATTTCACGGTCAACGCTTTCGATTTTGTTGATTTGATTCAGTTG
GCACGATGCGGGAACTTATGATGCAAAGACCAAGACCGGTGGACCTAATGCTTCTATTCGGAACGAGGAAGAGTTTTCTCATGGTGCTAATAATGGATTGAAGAAAGCTATTGATTTCTG
TG
TGGTATATTATTACTATTCTATTCAATTTAATCAATTTCACTTTCAGTTTTTGTTGTTGTAAAACTAGTATCAATATCATTGGTTTCTTATGTCACAGAGGAAGTGAAGGCAAAACAT
CCTAAGATTTCATATGCTGACCTTTATCAG
AGGTGATTATTTACCTTCACTCACTTGTTATGTAAATCTGCAATAAATCCAATAATTTTGTGTTCAAGTGGTTTTCTTAGAAATTGTAGA
ATGGGGTCAATGACTTTCAATTTTGTCTCCAGTGTGCAACATGATTTTTTGATTAGATAAATTTATTTATGTTATGTCTATTGTGGCGCTCCTATTTCTGCTACTTCCAATTTTCAACTT
AAATTGTCCTCTTTATACATTGTTTGTGACTCTGGACAGTCAAAACTCTGGGATTGCTGCTTTGTTTAGTTTTTTCATGCAGTGTTAGGTGGTATTAGTTTACCCAGTTCTTGTTTCTAT
TTTGAAACTGAATCTCATTGTTAGGTGGATTGTATGAATCTTGAAGTTACATACATAACATGCCCTTTGCTTACATTAGTGCTCTGTCCCATGATGCATGACAATTCCGAACTATAATAA
TTTAATATTACGATAACAAAGAGATTGACTAGCTTTGCTTAGTTAATCATCTCACTGCTTTGTTCTGTTTGTTTTTTCTATTCGCTTTTATGATTATGTGTTTTTTTTTCTTCTTCTTTC
TTTTCCTTGTGCTTGTTTACCTCTTTAAGAAATTGTCTTCTACCCAAAGACAAAAAAGGTTGATTGTTCTATTCAATCATCTACAGGCTTGGTTATCTTGCCTAAAGCTTTAATACTTTG
TGTGAGATTTCAAGGTTTTTAACAAAGTTGTCAAGGATTATATTATGCCTTGAATTAGGATAAGGTGGATTATTCTGTGATGAACCATTTGAAGGTGGAAAACTAACTTGTTTGCTCTAT
ACAAATTCCATTTTCTGAACTCTTTATTTGGTTAGTTCAGTTGTTTTATATGATTTGAGAGAAAATGCAGTTGTAATATATGAAGGTTACAACATCACCTTGTTCCCTTAAACAAATTTT
GGCAACATTCTGCCTCAATCATTTCAATGACACTGGTGACCAACTTCATACTACCCACAAGCCTTTCCTAGGCGAAAACGTGATGAAGAAAGAACTACATTTCTTGGTAGCTTTATGAAA
TCTGGAGTGATTACAGAAGTACACCTAAATTTTGATAGTTCAGAAATATATATAAGTGAAGCTCAAGTTCCTGTGTTGAGTTTCAAGTTTCATCATTTTAGCTTTTTACCTAGTGGAGGT
GTACTTCTTTTGTTTCTAGTAATTTACATGCATCCACTCTTAGTGGCGAATATCTCTACAAAGTTGAACGTCGATTGATTTTCATATACAGTAATTTTAAAAATTTGCAAGTTTTCCAAA
TTTACTTTTTGAAAATCGAAGATTCCCTTAATTACTGTATAAGTTTCTATCAAAATCAAGACAATTATTGGAGTTTCTTGCATATCACATATGAAGTGATTAAAACCGGTACATATTAAA
ATAGAGAGGAAGGGGGAGCATTATTTATCACTCGTGCAGGGCATGCCTTGTATAAAACAAGATATGCATTTGTTAGTGAAGAACTAAACCAGCTGCAACATAGATTACATGAATCTGAAA
CAACAATTATTTCTTTCCTGTGCTTCCAGCTTGCGGGTGTTGTTGCAGTTGAGGTTACTGGGGGTCCCACAGTCAACTTTGTTCCTGGAAGAAGGGGGTATGTTGTGCAATACCTTTCGT
TAGAATATTAGTTATGAAATCCTGAACTTGTCGTTCTCTAATTTTCTGTGTCATGTAGGATTCAAAAGTATGTACCAGAGACGGGCGACTTCCTGATGCTAAACAAGAGGTGTGTTACTA
AATTATTGTTAGTGTTACAACAGTTTTGTTCACTTGGGCATGGTAAATAGCTTACCATTGCCTGTGAAAAGATTTTCTTTTCTCTGAATTCCCTTCACATCAACAAAATTAAGAAATAAT
AATATTAAGACTTATATGAAAGCATGTAAACATGTCAATGCTATTGGTAGGTGTGTCGCATCTCCGTGATATCTTTTATCGTATGGGCTTGACTGACAAAGATATTGTTGCACTGTCTGG
GGCTCATACGCTG
TGGTGATTCTCCTTTCTATATCTTTTTATTATTTGCTGTGATTGCGGCCATAAATTCTTATTTTATTTTCTGTGTTTCAAGGGAAGAGCACATCCAGAGAGATCAGG
GTTTGATGGCCCTTGGACAGAGGACCCTCTGAAGTTTGATAACTCATATTTTCA
CAGTAAGACTTATGTTTTGTGCATTATCATCAGTTTTTTTTGCTTTACTACAAGGACATTTGTAGA
TTTTCAGTTTTACATCCCAATATGACAAGAGTTTGATTTTTTCATTTTTTTTTTTAATTTTTATTTCGGATAAAGAGCTGGATTTTTTATTTACCGCTAAATTTCATTGTCAATATCAGG
ATACTTTTGGAAGAAGATTCCGCAGCTCTGCTTAAACTTCCAACAGACAGGGCTTTATTGGATGATCCTGAATTTCGCCGTTATGTTGAGCTGTATGCGAAG
AGGTAATTGGGATTGTTT
AATTAAAATAACATAACATTTACATAATCCCTGGTGAAAACTGATTTCATAAAGTGTCCTGCCAAATATGGTTTTTCAATAGCATTTTATAAGTCCATTTGTAGTCTTGTTGCATTTGTT
TATTGGATCAATCTTTTGATTGGAACTCATTGCATTAAGTAGGTTGATTAGTAGGTCCTTCTTCCCGGTAAGCATTGTGCTTTGGAGTTTACTAATGCCATCTGCGATTATCACGATGTT
TCATAAGATTTCCTACATGTGCTAATTGGGTGGAAAAACCAACAGCTTTCTTACTTAATATGTGATAGATATGAGCTCTTTCTACGCGGCCAACTACTTAATATGTTGGTTTTGTTTTCC
TTCTGTTACAACTATTAAGGTTGAAGATCTACATTTAAACTAAATAACGTACTTATTAGATCATTTATATGGGACTAACCTACCCAAAACATTCATGCCAAGTTTCTGTTTTGCTCAAAA
ATCATTGAAGAAAATAAATAGTGGTTATTTGCGTCAAAGTTCTGAATTCTGTTGATCCATCATTAAATTAAATGAATCGTCTGCTGTTTCCTGTTTTTTCTTTCTTCTAATTCTCCCTCT
GGCAGGATGAGGATGCATTTTTTCGAGATTATGCTGAATCACATAAGAAACTTTCAGAGCTTGGCTTTGCGCCAAGCTCAAAGGCGACTGCTCCTGTGGATGCAACCGTACTGGCACAAA
GCGCTTTTGGAGTTGTAGCTGCCGCTGCAGTGGTGATCCTTGGTTACTTGTATGAAACTCACAAAAGAGGGAAGTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTTCCCGGTAGTAGTAGACTCAGAGTATCTCAAGGAAATCGAAAAAGCTCGTCGCGATCTCCGTGCTCTCATCGCCAACAGAAACTGTGCTCCCCTCATGCTTCGCTTAGCTTGG
CACGATGCGGGAACTTATGATGCAAAGACCAAGACCGGTGGACCTAATGCTTCTATTCGGAACGAGGAAGAGTTTTCTCATGGTGCTAATAATGGATTGAAGAAAGCTATTGATTTCTGT
G
AGGAAGTGAAGGCAAAACATCCTAAGATTTCATATGCTGACCTTTATCAGCTTGCGGGTGTTGTTGCAGTTGAGGTTACTGGGGGTCCCACAGTCAACTTTGTTCCTGGAAGAAGGGAT
TCAAAAGTATGTACCAGAGACGGGCGACTTCCTGATGCTAAACAAG
GTGTGTCGCATCTCCGTGATATCTTTTATCGTATGGGCTTGACTGACAAAGATATTGTTGCACTGTCTGGGGCT
CATACGCTG
GGAAGAGCACATCCAGAGAGATCAGGGTTTGATGGCCCTTGGACAGAGGACCCTCTGAAGTTTGATAACTCATATTTTCAGATACTTTTGGAAGAAGATTCCGCAGCTCTG
CTTAAACTTCCAACAGACAGGGCTTTATTGGATGATCCTGAATTTCGCCGTTATGTTGAGCTGTATGCGAAG
GATGAGGATGCATTTTTTCGAGATTATGCTGAATCACATAAGAAACTT
TCAGAGCTTGGCTTTGCGCCAAGCTCAAAGGCGACTGCTCCTGTGGATGCAACCGTACTGGCACAAAGCGCTTTTGGAGTTGTAGCTGCCGCTGCAGTGGTGATCCTTGGTTACTTGTAT
GAAACTCACAAAAGAGGGAAGTAG

Retrieve as FASTA