1. Browse the Database
  2. View Redoxidase
Entry information : MtPrx70 (Medtr5g074760.1[4.0] / Medtr5g074760[3.5] / Medtr5g082700.1[3.0])
Entry ID 395
Creation 2006-06-22 (Christophe Dunand)
Last sequence changes 2013-12-29 (Christophe Dunand)
Sequence status complete
Reviewer Messaoudi
Last annotation changes 2014-07-29 (Messaoudi)
Peroxidase information: MtPrx70 (Medtr5g074760.1[4.0] / Medtr5g074760[3.5] / Medtr5g082700.1[3.0])
Name (synonym) MtPrx70 (Medtr5g074760.1[4.0] / Medtr5g074760[3.5] / Medtr5g082700.1[3.0])
Class Class III peroxidase    [Orthogroup: Prx010]
Taxonomy Eukaryota Viridiplantae Streptophyta Fabaceae Medicago
Organism Medicago truncatula (barrel medic)    [TaxId: 3880 ]
Cellular localisation N/D
Tissue types Mycorrhizal roots
Root tips
Roots
Inducers Glomus intraradices infection
Mycorrhiza
Nitrogen starvation
Repressor N/D
Best BLASTp hits
Perox score E-value MtPrx70
start..stop		 S start..stop
MtPrx02 644 0 1..322 1..322
MtPrx86 605 0 1..322 1..322
GmPrx40 507 0 1..321 1..329
GmPrx120 495 1.37e-178 5..321 4..323
Gene structure Fichier Exons►


exon

Literature and cross-references MtPrx70 (Medtr5g074760.1[4.0] / Medtr5g074760[3.5] / Medtr5g082700.1[3.0])
Literature Manthey,K. et al., unpublished, Journet,E.P. et al, unpublished
Protein ref. UniProtKB:   Q1T3V2
DNA ref. Phytozome 12:   chr5 (31768790..31767323)
Cluster/Prediction ref. Phytozome Gene 12:   31089793
Omic ref. Gene atlas:   Mtr.14634.1.S1_at  Mtr.14635.1.S1_at  Mtr.14639.1.S1_x_at Legoo:   Mtr.14639.1.S1_x_at
Protein sequence: MtPrx70 (Medtr5g074760.1[4.0] / Medtr5g074760[3.5] / Medtr5g082700.1[3.0])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (300)
PWM (Da):   %s   35838.5 (33254.1)  
PI (pH):   %s   9.7 (9.70) Peptide Signal:   %s   cut: 24 range:24-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDSRFQFVLFVVTFATILSPTIAKLTPNYYDRICPKALPVIKSIV
KQAIIREPRMGASLLRLHFHDCFVNGCDGSVLLDDTPTFIGEKTAFPNINSIRGFEVVDQIKAAVTKACKRDVVSCADILAIAARDSVAILGGKQYWYQVLLGRRDSRFASRDAANTNLPPPFFNFSQLITNFKSHGLNLKDLVV
LSGGHTIGFSKCTNFRNRIYNDTNLDTNFAANLQKTCPKIGGDDNLAPFDSTPSRVDTKYYKALLNKQGLLHSDQELFKGDGSQSDRLVQLYSKNSYAFAYDFGVSMIKMGNLKPLTGKK
GEIRCNCRKVNQN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (chromo 5, introns 1 and 2) and ESTs: AW256592, BE239560, CX549881, AW256591, AJ502110, AW687603, AL370987, BE240571 (Unigene compiles ESTs from MtPrx70 and 02). AC123575 contain 4 peroxidases (MtPrx01, 02, 70, 86) and one pseudogene.
DNA ►
Send to BLAST
CDS►
Send to BLAST
cDNA►
Send to BLAST