1. Browse the Database
  2. View Redoxidase
Entry information : OsAPx11(LOC_Os09g36750)
Entry ID 3967
Creation 2008-09-02 (Christophe Dunand)
Last sequence changes 2008-09-02 (Christophe Dunand)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2022-02-12 (Christophe Dunand)
Peroxidase information: OsAPx11(LOC_Os09g36750)
Name OsAPx11(LOC_Os09g36750)
Class Ascorbate peroxidase    [Orthogroup: APx2003]
Taxonomy Viridiplantae (green plants); Streptophyta; Angiospermae; Monocotyledons
Organism Oryza sativa ssp japonica cv Nipponbare    [TaxId: 39947 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value OsAPx11
start..stop		 S start..stop
ZmAPx04 498 1.16e-180 1..289 1..289
SbAPx04 497 3.19e-180 1..289 1..289
ScAPx04 484 4.86e-175 1..289 1..291
TaAPx06-1A 482 1.89e-174 1..289 1..291
Gene structure Fichier Exons►


exon

Literature and cross-references OsAPx11(LOC_Os09g36750)
Literature Sasaki,T., Matsumoto,T. and Katayose,Y.Oryza sativa nipponbare(GA3) genomic DNA, chromosome 9, PAC clone:P0229B10 Published Only in Database (2003)
Protein ref. UniProtKB:   A2Z3J3 [Incorrect splicing]  Q69JE6 [Incorrect splicing] UniProtKB_Uniparc:   A3C114 [Incorrect splicing]
DNA ref. GenBank:   NC_008402.1 (20903600..20898483)
Cluster/Prediction ref. UniGene:   Os.55638 [3' end]
Protein sequence: OsAPx11(LOC_Os09g36750)
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   289 (310)
PWM (Da):   %s   31445.17 (35101.0) Transmb domain:   %s   o260-282i
PI (pH):   %s   7.03 (7.80) Peptide Signal:   %s   cut: 25 range:25-334
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAAPVVDAEYLRQVEGARRDLRALIASKGCAPIMLRLAWHDAGTYDAKTKTRGANGSIRHEEEYTHGSNAGLKIAIDLEPIKRKHPNITYADLYLAGVVAVEVTGGPTVDFVPGRRDSSVCPREGRLPDAKKGAPHLRDIFYQMGLTDKDIVALSGG
HTGKAHPERSGFDGAWTKEPLKFDNSYFLELLREESEGLLKLPTDRALLEDPEFRRFVDHYADEDAFFKDYAESHKKLSELGFAPRSSAKSDGSTAAATLAQSAFGVAVAAAVVVIAGYL
YESSKKTK*

Retrieve as FASTA  
Remarks Complete sequence from genomic DNA (chromo 9, 9 introns), 1 mRNA and 3 ESTs. Extra intron just before VALSGGHT (=> short exon). sequencing error or pseudogene? Incorrect prediction from Phytozome (only the second part is predicted)
DNA ►
Send to BLAST
CDS►
Send to BLAST